SecReT4
Protein ID: 261820921
T4SS name [ID]Tfc [694]
Gene symbol-
Locus tagPecwa_1630
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T4SS(s) in this replicon]
Location [Strand]1771147..1771827 [-]
Productsecreted protein
Component typeTfc12
UniProt IDD0KM59
KEGG IDpwa:Pecwa_1630
PDB IDNA
Domain hit(s) vs Pfam DUF2895 [PF11444], Evalue: 2.2e-87, Aligned region: 6..206
Protein Sequence: 226 a.a.     [Download]
>gi|261820921|ref|YP_003259027.1| secreted protein [Pectobacterium wasabiae WPP163]
MSRFKNEVTHLQAHIKTLRIGASALLLVALVMGAGWWNAPRDLTIHIPPDLRSGSSRAWWEVPPESVYAF
TFYVFQQLNRWPTNGEEDYTRNLHALSPYFTPACRAFLQADYDYRRSTGELRQRVRGVYEIPGRGYGDNP
TARVRVVSDRDWVVTLDLSADEYHGPEQVKRALVRYPVKVTRADIDPARNPFGLMLDCYDGAPQRIAAPA
QEAPSRGGLGTQGETP
 
Nucleotide Sequence: 681 bp     [Download]
>gi|261819370|ref|NC_013421.1|:c1771827-1771147 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGAGCCGATTCAAGAACGAAGTCACGCATCTACAAGCGCACATCAAGACCCTTCGCATCGGTGCCAGCG
CATTACTGCTGGTAGCACTGGTCATGGGTGCCGGTTGGTGGAACGCCCCGCGTGATCTGACGATCCATAT
CCCCCCAGATCTGCGTTCGGGGAGTTCCCGGGCCTGGTGGGAAGTGCCCCCCGAATCGGTCTATGCCTTC
ACCTTCTATGTGTTCCAGCAACTCAACCGCTGGCCGACTAACGGAGAAGAGGACTACACGCGCAACCTCC
ATGCACTATCACCGTATTTCACCCCGGCATGCCGTGCCTTTTTGCAGGCAGATTACGACTATCGCCGCAG
CACGGGCGAACTGCGGCAACGTGTACGCGGCGTCTACGAAATTCCCGGTCGCGGCTATGGCGATAACCCT
ACAGCACGGGTACGCGTGGTCTCTGATCGTGATTGGGTCGTCACACTCGACCTCAGCGCCGACGAGTACC
ACGGCCCGGAGCAGGTCAAACGCGCTCTGGTGCGCTATCCAGTGAAAGTCACGCGTGCAGATATCGATCC
AGCCCGTAACCCGTTCGGCCTCATGCTGGACTGCTATGACGGTGCCCCGCAGCGCATCGCAGCCCCGGCA
CAGGAAGCCCCCAGTCGCGGCGGCCTGGGCACACAAGGAGAAACCCCATGA
 Primer design