SecReT4
Protein ID: 261820922
T4SS name [ID]Tfc [694]
Gene symbol-
Locus tagPecwa_1631
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T4SS(s) in this replicon]
Location [Strand]1771824..1772222 [-]
Producthypothetical protein
Component typeTfc11
UniProt IDD0KM60
KEGG IDpwa:Pecwa_1631
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 2e-47, Aligned region: 10..130
Protein Sequence: 132 a.a.     [Download]
>gi|261820922|ref|YP_003259028.1| hypothetical protein Pecwa_1631 [Pectobacterium wasabiae WPP163]
MSEPPHVRTDGTITFLPHRLNRHPVVVRGLTADELWICCGLSGSAGLIIGVPLSWLLSTIALAPTCIVLG
IACGVFIGGGFLRRQKRGRPDTWLYRQLQWHITTRYPLLTDWVGGHLLITRSGSWSNRRTTR
 
Nucleotide Sequence: 399 bp     [Download]
>gi|261819370|ref|NC_013421.1|:c1772222-1771824 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGTCAGAGCCTCCACATGTCCGTACGGACGGCACCATCACGTTCCTGCCACATCGGCTTAATCGACATC
CGGTGGTGGTACGCGGCCTGACGGCTGATGAGCTGTGGATCTGTTGCGGCCTGTCCGGTAGCGCCGGGCT
GATCATCGGCGTGCCGCTGTCCTGGTTGCTTTCAACCATCGCTCTGGCACCGACCTGCATTGTGCTGGGC
ATCGCCTGCGGCGTGTTCATCGGTGGCGGCTTCCTGCGACGACAGAAACGCGGCCGGCCTGATACCTGGC
TGTACCGCCAGTTGCAATGGCACATCACGACTCGCTACCCGCTGCTCACAGACTGGGTTGGCGGACACCT
GCTGATCACGCGTTCAGGCTCCTGGTCGAATAGAAGGACAACGCGATGA
 Primer design