SecReT4
Protein ID: 261820923
T4SS name [ID]Tfc [694]
Gene symbol-
Locus tagPecwa_1632
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T4SS(s) in this replicon]
Location [Strand]1772235..1772591 [-]
Producthypothetical protein
Component typeTfc10
UniProt IDD0KM61
KEGG IDpwa:Pecwa_1632
PDB IDNA
Domain hit(s) vs Pfam DUF2976 [PF11190], Evalue: 3.5e-35, Aligned region: 31..117
Protein Sequence: 118 a.a.     [Download]
>gi|261820923|ref|YP_003259029.1| hypothetical protein Pecwa_1632 [Pectobacterium wasabiae WPP163]
MKHHLSPARLAQHAALAMGLTLPALSFAQGLPQLENPSRGTGGGIMETIRNYGYDIVLLVALLVVASMFI
GVCYHAYGTYAEIHNGKKTWGQFGLTVAVGAVLLVIGIWLLTEATGIL
 
Nucleotide Sequence: 357 bp     [Download]
>gi|261819370|ref|NC_013421.1|:c1772591-1772235 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGAAACACCACTTATCTCCCGCTCGTCTCGCGCAACATGCAGCACTGGCCATGGGTCTTACCTTACCTG
CACTGTCGTTCGCTCAAGGATTGCCGCAACTGGAAAACCCGTCTCGGGGCACCGGTGGCGGCATTATGGA
AACCATCCGCAATTACGGCTACGACATCGTGCTGCTGGTGGCTCTTCTGGTGGTCGCCAGCATGTTCATC
GGCGTGTGCTATCACGCCTACGGCACCTACGCCGAAATCCACAACGGCAAGAAAACCTGGGGTCAATTCG
GCCTGACGGTCGCCGTTGGGGCGGTGCTGCTGGTGATCGGCATCTGGCTGCTCACCGAAGCCACCGGCAT
TTTGTAA
 Primer design