SecReT4
Protein ID: 261820925
T4SS name [ID]Tfc [694]
Gene symbol-
Locus tagPecwa_1634
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T4SS(s) in this replicon]
Location [Strand]1772842..1773222 [-]
Producthypothetical protein
Component typeTfc9
UniProt IDD0KM63
KEGG IDpwa:Pecwa_1634
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 2.1e-28, Aligned region: 31..109
Protein Sequence: 126 a.a.     [Download]
>gi|261820925|ref|YP_003259031.1| hypothetical protein Pecwa_1634 [Pectobacterium wasabiae WPP163]
MVLPAQLRAVRRSAPIFLSAALMLGSSFSVYADTPAQSQDLAAALRQLDALERLVVQSASRTPAEPGERY
YFDYPRLRDDIARIRIGIQAHLTPSRAQPRDLAELNGNYRQESTEKHGDTFLKNQP
 
Nucleotide Sequence: 381 bp     [Download]
>gi|261819370|ref|NC_013421.1|:c1773222-1772842 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGGTTCTCCCAGCCCAGCTTCGCGCTGTACGCCGCAGCGCGCCCATCTTTCTCTCCGCAGCCCTCATGC
TCGGCAGTTCGTTCTCTGTCTATGCCGACACACCGGCGCAGAGCCAGGATCTTGCTGCTGCGCTAAGGCA
ACTCGACGCATTGGAACGCCTCGTCGTGCAGAGCGCATCCAGAACCCCCGCAGAGCCAGGCGAACGCTAT
TACTTCGACTACCCAAGGCTACGCGATGACATTGCTCGCATACGCATCGGTATCCAGGCTCATCTCACGC
CATCCCGCGCCCAGCCACGCGACCTTGCCGAACTGAACGGTAACTACCGTCAAGAATCGACAGAAAAACA
CGGCGACACCTTCCTGAAGAACCAGCCATGA
 Primer design