SecReT4
Protein ID: 261820928
T4SS name [ID]Tfc [694]
Gene symbol-
Locus tagPecwa_1637
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T4SS(s) in this replicon]
Location [Strand]1774547..1775296 [-]
Producthypothetical protein
Component typeTfc8
UniProt IDD0KM66
KEGG IDpwa:Pecwa_1637
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 1.5e-68, Aligned region: 47..246
Protein Sequence: 249 a.a.     [Download]
>gi|261820928|ref|YP_003259034.1| hypothetical protein Pecwa_1637 [Pectobacterium wasabiae WPP163]
MSDPAATAQHQQTRRKSLLASVITLPFRLVGVLIGSLLISIIVECAGMHLFWKDQGWQHAQAMLQYELGH
LSNNFTRSVIVQEPGRTAHQLIDTGYEWMFVKTGLLERMQQTAERARAPSQTPSRNFRYFVSQVYVWSEN
YLIAAAFTVLTFMVRLLVLVLTLPLIVMAVFVGLVDGLVRRDVRRFGAGRESGFVYHRAKAALLPLAVLP
WVTYLTLPVSVHPMMILLPSAGLLGVAVVLTASSFKKYL
 
Nucleotide Sequence: 750 bp     [Download]
>gi|261819370|ref|NC_013421.1|:c1775296-1774547 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGAGCGATCCAGCGGCTACGGCACAACATCAGCAGACACGCCGGAAAAGCCTGCTGGCCAGTGTCATTA
CCTTGCCATTCAGGTTAGTGGGAGTGCTGATTGGCTCATTGCTGATTTCTATCATCGTGGAATGCGCAGG
TATGCATCTTTTCTGGAAAGACCAGGGCTGGCAACACGCGCAGGCGATGCTGCAGTACGAATTGGGACAC
CTGTCGAATAACTTTACCCGCAGCGTCATCGTGCAGGAGCCGGGCCGCACGGCACACCAGCTCATCGACA
CCGGCTATGAATGGATGTTCGTCAAGACCGGACTGCTTGAGCGCATGCAGCAAACCGCCGAGCGTGCGCG
AGCTCCCAGCCAGACACCCAGTCGGAACTTCCGCTACTTTGTGAGCCAAGTCTATGTATGGTCGGAAAAC
TATCTGATCGCCGCAGCCTTCACCGTACTGACGTTCATGGTGCGCTTGCTGGTGCTGGTGCTGACATTGC
CGCTCATTGTCATGGCTGTGTTTGTAGGCCTGGTTGATGGTCTGGTGCGGCGCGATGTACGCAGGTTTGG
AGCGGGTCGGGAATCGGGCTTCGTTTACCACAGGGCAAAGGCCGCGTTACTGCCGCTGGCTGTGTTGCCC
TGGGTAACTTACCTGACACTGCCAGTTTCGGTGCACCCGATGATGATTCTGCTGCCTAGTGCTGGATTGC
TGGGCGTTGCGGTGGTGCTGACAGCGAGTAGTTTTAAGAAGTATCTTTAG
 Primer design