SecReT4
Protein ID: 261820929
T4SS name [ID]Tfc [694]
Gene symbol-
Locus tagPecwa_1638
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T4SS(s) in this replicon]
Location [Strand]1775293..1777452 [-]
Producthypothetical protein
Component typeTfc6
UniProt IDD0KM67
KEGG IDpwa:Pecwa_1638
PDB IDNA
Domain hit(s) vs Pfam TraG-D_C [PF12696], Evalue: 4.4e-16, Aligned region: 507..637
TrwB_AAD_bind [PF10412], Evalue: 2.2e-10, Aligned region: 508..648
AAA_10 [PF12846], Evalue: 4.7e-08, Aligned region: 191..585
Protein Sequence: 719 a.a.     [Download]
>gi|261820929|ref|YP_003259035.1| hypothetical protein Pecwa_1638 [Pectobacterium wasabiae WPP163]
MAQSQPVEVLLRPPVELYTVAVCAGAALLCLTAPWSLALSPDIGIGSALAFGIFGTLRWRDAQVILRYRR
NIRRLPRYVMTSRDVPVSQQRLFIGKGFRWEQKHTHRLMQTYRPEFRRYVEPTSAYQLARRLEERLEFAP
FPLSQLPRLTTWDIPLNPVRPLPPVGGLPRLHGIEPDEVDVSLPLGERVGHSLVLGTTRVGKTRLAELFI
TQDIRRKNHLSEHEVVIVFDPKGDADLLKRMFVEARRAGRENAFYVFHLGWPEISARYNAVGRFGRISEV
ATRIAGQLSGEGNSAAFREFAWRFVNVIARALIELGQRPDYLLIQRHVINIDALFIEYAQHYFVRTEPKA
WEVIVQIEAKLNEKNIPRNMIGREKRVVALEQYLSQARNYDPVLDGLRSAVRYDKTYFDKIVASLLPLLE
KLTSGKIAQLLAPNYSDLSDPRPIFDWMQIIRKRAVVYVGLDALSDAEVAAAVGNSMFSDMVSVAGHIYK
FGIDDGLPGASADTKVPINVHADEFNELMGDEFIPMINKGGGAGIQVTAYTQTLSDIEARIGNRAKAGQV
VGNFNNLFMLRVRETATAELLTKQLPKVEVYTTTVVSGATDSSDIHAKTDFTSNTQDRISMSSVPMIEPS
HVVQLPKGQCFALLQGGNLWKVRMPLPAPDPDEIMPADLQQLAGYMRQSYTDTGQWWQNQGSPTLQEQAL
PPELLDEDADPIIDESKAP
 
Nucleotide Sequence: 2160 bp     [Download]
>gi|261819370|ref|NC_013421.1|:c1777452-1775293 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGGCACAGTCTCAGCCGGTCGAGGTACTGCTGCGTCCCCCAGTAGAACTCTATACCGTTGCGGTTTGCG
CCGGGGCCGCATTGCTGTGCCTGACGGCTCCATGGTCTCTCGCGCTGAGTCCGGACATAGGCATCGGCAG
CGCACTGGCCTTCGGAATTTTTGGCACACTGCGCTGGCGCGATGCACAGGTGATCCTGCGCTACCGACGC
AATATCCGTCGCCTGCCGCGTTACGTGATGACCAGCCGCGACGTGCCAGTCAGCCAACAACGCTTGTTCA
TTGGCAAAGGGTTTCGTTGGGAGCAAAAACACACTCACCGGTTGATGCAAACCTATCGGCCTGAGTTCAG
GCGTTATGTAGAGCCGACATCCGCCTACCAGTTGGCCCGACGTCTGGAGGAGCGGCTGGAGTTTGCACCA
TTTCCATTATCGCAACTGCCCCGTCTTACGACCTGGGATATACCGCTCAATCCGGTGCGGCCATTACCGC
CCGTTGGCGGCTTACCGCGTCTGCATGGTATTGAGCCTGACGAGGTGGACGTCAGCCTGCCCTTGGGTGA
GCGTGTTGGTCACTCCCTGGTACTGGGCACCACACGCGTAGGCAAAACGCGGCTGGCTGAATTATTCATC
ACCCAGGATATTCGTCGAAAAAATCACCTGAGCGAGCACGAAGTGGTCATTGTTTTCGACCCTAAAGGCG
ACGCGGATCTGCTCAAGAGAATGTTCGTCGAGGCCAGACGTGCAGGAAGAGAGAATGCGTTCTACGTGTT
TCATCTGGGGTGGCCGGAGATCAGCGCTCGTTACAACGCGGTGGGACGTTTTGGCCGCATCAGTGAAGTC
GCGACCCGCATCGCAGGGCAGCTTTCCGGAGAGGGTAACTCTGCTGCATTCAGAGAATTTGCCTGGAGAT
TCGTCAATGTGATTGCACGTGCATTGATCGAGCTGGGGCAACGACCTGACTACCTGCTGATCCAGCGCCA
TGTCATCAATATCGATGCGTTGTTCATCGAGTACGCCCAACACTACTTCGTCCGCACAGAACCGAAAGCC
TGGGAGGTCATCGTCCAGATTGAAGCCAAGCTCAACGAGAAGAACATTCCCAGGAACATGATCGGTCGCG
AAAAGCGCGTGGTTGCCCTTGAGCAATACCTCAGCCAGGCCCGTAACTACGATCCCGTACTGGACGGACT
GAGATCAGCGGTTCGCTACGACAAAACGTACTTTGACAAGATCGTCGCCAGCCTGCTGCCTCTGCTTGAA
AAACTCACCAGCGGCAAAATCGCCCAATTGCTGGCACCGAACTACTCGGATCTGAGTGACCCCAGGCCGA
TTTTCGACTGGATGCAGATCATCAGGAAACGCGCGGTCGTCTACGTCGGACTCGATGCGCTCTCCGATGC
CGAAGTCGCCGCTGCGGTGGGCAACTCGATGTTCAGCGATATGGTCTCGGTGGCCGGACACATCTATAAA
TTCGGCATCGACGATGGCCTGCCCGGTGCATCGGCTGACACCAAAGTACCAATCAATGTTCATGCCGATG
AATTCAATGAACTGATGGGAGACGAATTCATCCCGATGATCAACAAAGGCGGCGGTGCTGGCATCCAGGT
CACCGCTTATACCCAAACCCTCAGTGATATTGAAGCCCGCATCGGCAATCGCGCCAAAGCCGGTCAAGTC
GTCGGCAATTTCAACAACCTGTTCATGCTGCGCGTGCGCGAGACAGCCACCGCCGAACTGCTCACAAAAC
AGTTGCCCAAGGTGGAGGTCTACACGACGACCGTGGTCAGCGGCGCGACAGACAGCTCCGACATCCACGC
CAAAACCGACTTCACCAGCAACACACAGGATCGCATCAGCATGTCGAGCGTGCCGATGATTGAGCCGTCA
CACGTCGTTCAACTTCCGAAAGGGCAATGCTTTGCACTGCTACAGGGTGGCAACCTGTGGAAAGTCCGCA
TGCCCCTGCCCGCCCCCGATCCAGATGAAATCATGCCGGCCGATCTTCAGCAATTGGCTGGCTACATGCG
CCAAAGCTACACCGATACAGGTCAATGGTGGCAGAACCAGGGCTCGCCTACGCTACAGGAGCAAGCGCTA
CCGCCTGAACTGCTTGATGAGGATGCCGACCCTATTATCGACGAGAGTAAAGCGCCATGA
 Primer design