SecReT4
Protein ID: 261820930
T4SS name [ID]Tfc [694]
Gene symbol-
Locus tagPecwa_1639
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T4SS(s) in this replicon]
Location [Strand]1777457..1777996 [-]
Producthypothetical protein
Component typeTfc5
UniProt IDD0KM68
KEGG IDpwa:Pecwa_1639
PDB IDNA
Domain hit(s) vs Pfam DUF2859 [PF11072], Evalue: 3.2e-48, Aligned region: 31..178
Protein Sequence: 179 a.a.     [Download]
>gi|261820930|ref|YP_003259036.1| hypothetical protein Pecwa_1639 [Pectobacterium wasabiae WPP163]
MTTHIKTAYSLFLTLTTVSPLIHAAQPPIVVEDHGGASALPYYEALNLQVRSPDTPRPPIAMPPIQVNPA
TEADMLPVRSPKLSSGTVARRVIDAPGLQPFFLVGDDEASHAWLQRQSVLLHERGAIGLVVNVETEDGLA
RLRAIAPGLQFAPVAADDLTERLGLRHYPALITSTGIEQ
 
Nucleotide Sequence: 540 bp     [Download]
>gi|261819370|ref|NC_013421.1|:c1777996-1777457 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGACAACCCACATCAAGACGGCATACAGCCTGTTCCTGACACTGACAACAGTATCGCCATTGATTCATG
CAGCACAGCCGCCGATCGTGGTGGAAGACCACGGCGGAGCCTCTGCTCTGCCGTACTACGAGGCGCTCAA
CCTTCAGGTACGCTCACCCGATACCCCACGCCCTCCCATTGCCATGCCGCCGATACAGGTAAACCCAGCA
ACCGAAGCAGACATGCTGCCAGTACGCAGCCCGAAGCTCTCCTCTGGCACCGTAGCACGCCGGGTCATCG
ATGCACCGGGCCTGCAACCGTTCTTTCTGGTCGGCGACGATGAGGCATCCCATGCGTGGCTGCAGCGCCA
AAGCGTATTACTTCACGAACGAGGTGCCATCGGCCTGGTGGTCAACGTCGAGACCGAAGACGGCCTGGCA
CGCCTGCGTGCTATCGCACCAGGTCTGCAGTTTGCGCCAGTGGCGGCCGATGACCTGACTGAGCGACTTG
GCCTGCGGCATTACCCCGCGCTCATCACCAGCACGGGCATTGAGCAATAA
 Primer design