SecReT4
Protein ID: 261820931
T4SS name [ID]Tfc [694]
Gene symbol-
Locus tagPecwa_1640
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T4SS(s) in this replicon]
Location [Strand]1777993..1778583 [-]
Productlytic transglycosylase
Component typeTfc4
UniProt IDD0KM69
KEGG IDpwa:Pecwa_1640
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 196 a.a.     [Download]
>gi|261820931|ref|YP_003259037.1| lytic transglycosylase [Pectobacterium wasabiae WPP163]
MAASALTSMQRRWTLLVSILMAGLAQAQEIPPPAYQLAAQRAGVPSVVLYAVALQESGVRRAERIVPWPW
SLNVAGQSRRYTSQAQACAGVHQALQDVPLARIDVGLGQINLGWQKHRYRQPCDLLDPYNNLTIAAQILK
EQHIPGEDWLLAMGRYHRPAGGAPAARYRRSVLQHLQRVLGPQQTIPTTLSKETTP
 
Nucleotide Sequence: 591 bp     [Download]
>gi|261819370|ref|NC_013421.1|:c1778583-1777993 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGGCAGCGTCAGCCCTGACATCCATGCAACGAAGGTGGACGTTGCTGGTCAGCATACTGATGGCTGGCC
TGGCTCAGGCTCAGGAGATCCCCCCACCGGCCTACCAGTTGGCGGCTCAACGCGCGGGTGTTCCCTCTGT
CGTCCTTTATGCAGTGGCGTTGCAGGAAAGTGGTGTGCGCCGTGCAGAACGTATCGTGCCGTGGCCGTGG
TCGCTGAATGTGGCAGGCCAGTCTCGCCGATACACCAGCCAGGCTCAGGCCTGTGCAGGAGTACACCAGG
CCCTGCAAGACGTACCACTTGCCCGCATTGACGTGGGCCTGGGGCAGATCAATCTCGGTTGGCAAAAGCA
TCGCTACCGCCAGCCCTGCGACTTACTCGATCCGTACAACAACCTGACGATCGCGGCACAGATCCTCAAG
GAGCAGCATATCCCCGGCGAAGACTGGCTGCTGGCAATGGGCCGCTACCACCGGCCTGCTGGCGGTGCGC
CTGCGGCACGCTACCGGCGCAGTGTGTTGCAACACCTTCAACGCGTATTGGGGCCGCAGCAAACTATCCC
CACCACTCTCAGCAAGGAAACCACCCCATGA
 Primer design