SecReT4
Protein ID: 261820932
T4SS name [ID]Tfc [694]
Gene symbol-
Locus tagPecwa_1641
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T4SS(s) in this replicon]
Location [Strand]1778565..1779296 [-]
Productsecreted protein
Component typeTfc3
UniProt IDD0KM70
KEGG IDpwa:Pecwa_1641
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 243 a.a.     [Download]
>gi|261820932|ref|YP_003259038.1| secreted protein [Pectobacterium wasabiae WPP163]
MKRLMTILLTATLATLTLATLTMSAMAQPSTTMQSRIVPTQVEQHRDERLAQDWGLNTDEWLRYRELMEG
PLGTYSPNLDPLSALGIEARSDDERQRYAELQVQTEARRVEKLLAYQRAYDEAWQRQNPDMLRVNLPDAG
LNKNTVTGNGRTAVFVKENCQPCAQLVQRLQTSGTPFDLYMVGSRQDDARIRDWARRAQIDPEQVRNSTI
TLNHDAGRWLSLGLSGDLPASVRQVNGQWQRQP
 
Nucleotide Sequence: 732 bp     [Download]
>gi|261819370|ref|NC_013421.1|:c1779296-1778565 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGAAACGTCTGATGACGATCCTCCTCACTGCCACACTGGCCACTCTGACACTGGCCACTCTGACAATGT
CCGCGATGGCACAGCCCTCCACCACGATGCAATCCCGTATCGTACCGACCCAGGTCGAACAGCACCGGGA
CGAACGTCTGGCGCAGGACTGGGGCTTGAACACTGACGAATGGTTGCGCTATCGCGAACTCATGGAGGGG
CCCCTCGGCACCTACTCACCCAACCTCGACCCACTATCAGCATTGGGCATCGAGGCCCGCAGTGACGACG
AGCGACAACGCTATGCCGAACTACAAGTACAGACAGAAGCACGTCGTGTTGAAAAACTGCTGGCTTATCA
GCGAGCGTACGACGAAGCCTGGCAAAGACAGAATCCCGACATGCTGCGGGTAAATTTGCCTGATGCCGGA
CTCAACAAAAACACGGTAACCGGAAACGGACGCACGGCGGTGTTCGTCAAGGAGAATTGCCAACCATGCG
CCCAACTTGTGCAGCGCTTACAGACCTCCGGCACGCCCTTCGACCTGTATATGGTCGGTTCACGCCAGGA
CGATGCACGCATCCGGGATTGGGCCAGACGCGCACAGATTGACCCAGAGCAGGTACGCAATAGCACCATC
ACACTGAACCACGACGCAGGTCGCTGGTTGTCTCTTGGGCTGTCCGGAGACCTGCCCGCCAGTGTCAGAC
AGGTAAATGGTCAATGGCAGCGTCAGCCCTGA
 Primer design