SecReT4
Protein ID: 261820934
T4SS name [ID]Tfc [694]
Gene symbol-
Locus tagPecwa_1643
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T4SS(s) in this replicon]
Location [Strand]1779955..1780524 [-]
Productsecreted protein
Component typeTfc2
UniProt IDD0KM72
KEGG IDpwa:Pecwa_1643
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 189 a.a.     [Download]
>gi|261820934|ref|YP_003259040.1| secreted protein [Pectobacterium wasabiae WPP163]
MSPTHSTQRLFVSHLLIIAALSSGCTTTTAPPHSPPIKAVASVPDATPDFIPVLRYGRYTLIELAPDAAQ
RDLLLQVIDVSIPEHSRATVGDGLRHALKRSGYQLCETAQSVIELYSLPLPAAHLHLGPMTLRETLLTLA
GPYWALYVDNRTRQVCFKRPDIDAGAGTANGDTQVADAVKPLPPAGGQP
 
Nucleotide Sequence: 570 bp     [Download]
>gi|261819370|ref|NC_013421.1|:c1780524-1779955 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGTCACCCACACATTCAACCCAGCGGCTGTTTGTCAGTCACCTGCTGATCATTGCAGCCTTGAGCAGCG
GATGTACAACAACCACTGCCCCGCCCCACTCTCCGCCCATCAAAGCGGTCGCCTCGGTTCCCGACGCTAC
GCCGGATTTCATTCCCGTTCTACGTTACGGACGCTATACCCTGATCGAACTGGCTCCCGATGCGGCGCAG
CGTGATCTGTTGCTGCAGGTGATCGACGTATCAATACCCGAGCATTCCCGCGCTACCGTGGGTGATGGCT
TGCGGCACGCCCTCAAGCGAAGTGGCTACCAGCTTTGCGAAACGGCCCAGTCTGTTATTGAACTCTATTC
ACTGCCACTGCCCGCTGCTCATCTACACCTCGGCCCGATGACCTTGCGGGAGACATTACTTACCTTAGCC
GGGCCGTACTGGGCGCTGTACGTCGATAACCGTACACGACAAGTGTGCTTCAAACGCCCCGATATCGACG
CTGGCGCTGGCACAGCAAATGGCGACACTCAGGTCGCCGATGCAGTTAAGCCCCTCCCTCCTGCCGGAGG
GCAACCATGA
 Primer design