SecReT4
Protein ID: 261856206
T4SS name [ID]Trb [265]
Gene symbol-
Locus tagHneap_1614
StrainHalothiobacillus neapolitanus c2
Repliconchromosome [GenBank: NC_013422] [Browse all T4SS(s) in this replicon]
Location [Strand]1753244..1754725 [-]
ProductP-type conjugative transfer protein TrbL
Component typeTrbL
UniProt IDD0L169
KEGG IDhna:Hneap_1614
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.3e-25, Aligned region: 65..296
Protein Sequence: 493 a.a.     [Download]
>gi|261856206|ref|YP_003263489.1| P-type conjugative transfer protein TrbL [Halothiobacillus neapolitanus c2]
MSTKSTNILILTTICLLLATSSASAASTSTGGMMMDLMDQFHTASVSWTTRALQIGNWIFYTLAVLELTW
AAALWVMEKDSASSLIVALVRKFMVLGFFYTFLIMAPSWIPAIINSLQDTGAQIGDTTVGAVTPMSIVGH
GINVINAIWKAFSNSALGSLKAMATAIVIGFLLIAVSIAIMLSFIYIAIEYVMTVIESYIVVGMGLVLMG
FSGSQWTRDFSQKYIGYAFSVGVKLMVLMLLLATIITVTNTWPADVRATFTGKDMFAWIQPMFMIAGSSI
LMALLAIKIPSLASSLLSGAPSLGGAAAVGAAAGAAAGVAGMAVGGAKLAGMAGAAGGAATKGIAAAAVG
GAGMAQAVGAASNLATASGFTPGSAAHMGATAGNMINGLGGMAANGMKNLSNKAGSALDAATQSAGKTFD
TAVSNSTGGKLAASLNEKASGKQTSSGSQLGGGGRIPQAVVPPPRFRRHRPAVRRLAMEITQISPPRPMR
VSI
 
Nucleotide Sequence: 1482 bp     [Download]
>gi|261854630|ref|NC_013422.1|:c1754725-1753244 Halothiobacillus neapolitanus c2 chromosome, complete genome
ATGAGTACAAAATCCACAAACATTTTGATTCTGACGACGATCTGCCTGTTATTGGCAACATCGTCGGCAT
CCGCCGCCTCTACGTCAACCGGCGGCATGATGATGGATCTCATGGATCAGTTTCACACCGCTTCTGTCAG
TTGGACAACTCGTGCCCTGCAAATCGGGAATTGGATTTTCTATACCTTGGCCGTGCTTGAGTTGACGTGG
GCTGCCGCTCTTTGGGTAATGGAAAAGGATAGTGCCAGCTCATTGATTGTCGCTCTGGTAAGAAAATTCA
TGGTGCTGGGGTTTTTCTACACCTTTCTGATTATGGCTCCGTCATGGATACCGGCCATCATTAATTCCCT
ACAGGATACGGGAGCCCAGATTGGCGATACTACCGTTGGCGCGGTCACTCCAATGAGTATCGTTGGTCAT
GGAATCAATGTGATCAATGCCATCTGGAAAGCCTTTTCCAATTCCGCTTTGGGGAGTCTGAAAGCCATGG
CTACTGCGATTGTGATCGGGTTCCTTCTGATAGCTGTGTCTATCGCCATCATGTTGTCGTTTATCTACAT
TGCCATTGAATATGTGATGACCGTTATTGAATCCTACATCGTGGTGGGAATGGGGCTTGTGTTGATGGGG
TTTTCAGGGAGCCAGTGGACACGGGACTTTTCCCAGAAATATATCGGGTACGCATTTTCTGTTGGCGTGA
AGCTCATGGTGTTGATGTTGCTTTTGGCAACCATCATCACTGTCACAAACACTTGGCCAGCCGATGTACG
AGCCACTTTCACCGGCAAGGATATGTTCGCTTGGATTCAGCCTATGTTCATGATTGCCGGATCATCAATT
CTGATGGCATTGCTCGCCATTAAAATCCCCTCCCTTGCCTCATCCTTGCTCTCCGGCGCGCCTTCTTTGG
GCGGTGCCGCTGCGGTTGGGGCGGCGGCGGGCGCCGCTGCCGGGGTAGCGGGCATGGCGGTTGGTGGGGC
AAAATTGGCTGGAATGGCCGGGGCTGCGGGAGGTGCTGCCACCAAAGGCATCGCGGCGGCTGCTGTTGGC
GGTGCTGGCATGGCTCAGGCTGTGGGCGCCGCATCAAACCTTGCCACGGCATCGGGCTTTACACCGGGAT
CAGCGGCTCACATGGGGGCTACTGCGGGCAACATGATCAATGGACTCGGCGGCATGGCTGCAAATGGCAT
GAAAAACTTATCGAATAAGGCCGGATCAGCGCTTGATGCGGCCACGCAAAGCGCTGGAAAAACATTCGAC
ACAGCCGTGTCAAATTCCACTGGCGGCAAACTGGCTGCAAGCCTGAATGAGAAAGCATCTGGAAAGCAGA
CTTCTAGTGGGAGCCAATTGGGCGGGGGGGGGCGAATACCCCAAGCGGTGGTTCCGCCGCCACGGTTCCG
CCGCCATCGCCCGGCGGTCAGGCGCCTGGCAATGGAAATAACCCAAATCAGCCCGCCCCGCCCAATGCGA
GTCAGCATCTAA
 Primer design