SecReT4
Protein ID: 261856211
T4SS name [ID]Trb [265]
Gene symbol-
Locus tagHneap_1619
StrainHalothiobacillus neapolitanus c2
Repliconchromosome [GenBank: NC_013422] [Browse all T4SS(s) in this replicon]
Location [Strand]1758692..1759111 [-]
ProductConjugal transfer protein TrbC
Component typeTrbC
UniProt IDD0L174
KEGG IDhna:Hneap_1619
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 6.3e-18, Aligned region: 36..130
Protein Sequence: 139 a.a.     [Download]
>gi|261856211|ref|YP_003263494.1| Conjugal transfer protein TrbC [Halothiobacillus neapolitanus c2]
MKKVLSVFRRAGDAVNNKIYHFATIGAADERVTKMGRRFAFLGVLGAAAMAVSEPSMAGTATGLPWETPM
DTIKSSLTGPIALAISIIALAAAGAALVFGGELSEFTRKIIMLVMALALLVSGASIMTKLFAASGAIIH
 
Nucleotide Sequence: 420 bp     [Download]
>gi|261854630|ref|NC_013422.1|:c1759111-1758692 Halothiobacillus neapolitanus c2 chromosome, complete genome
ATGAAAAAAGTCCTGTCTGTTTTCCGCCGCGCTGGCGATGCCGTCAATAACAAAATCTACCACTTCGCCA
CGATTGGCGCCGCCGATGAGCGTGTGACCAAAATGGGGCGGCGTTTCGCCTTTCTCGGCGTATTGGGTGC
GGCCGCCATGGCTGTATCCGAACCCTCCATGGCAGGCACCGCTACCGGGCTGCCTTGGGAAACGCCCATG
GATACCATCAAATCGTCATTGACCGGCCCGATTGCCTTGGCGATTTCAATTATTGCCTTGGCTGCTGCCG
GTGCCGCTCTAGTTTTTGGCGGTGAGCTGTCTGAGTTCACCCGAAAAATCATCATGCTGGTGATGGCCTT
GGCATTGCTGGTTTCCGGTGCGTCGATCATGACCAAACTCTTTGCCGCTTCTGGCGCAATCATCCACTAA
 Primer design