SecReT4
Protein ID: 261856256
T4SS name [ID]Trb [265]
Gene symbol-
Locus tagHneap_1666
StrainHalothiobacillus neapolitanus c2
Repliconchromosome [GenBank: NC_013422] [Browse all T4SS(s) in this replicon]
Location [Strand]1792655..1793671 [+]
ProductP-type conjugative transfer protein TrbG
Component typeTrbG
UniProt IDD0L1B9
KEGG IDhna:Hneap_1666
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 2.6e-58, Aligned region: 98..317
Protein Sequence: 338 a.a.     [Download]
>gi|261856256|ref|YP_003263539.1| P-type conjugative transfer protein TrbG [Halothiobacillus neapolitanus c2]
MNKPILIRGRMLSPLARAVAIGIALSVTSVAFAEPVVPAIEHGGAETRPSQANTVAMPRHLNLTPIPIPH
PAVMASTMSERFLQNPKAIPAQGNNGQVTFVYGQSVPTITCAPLRICDISLEPGEVINGAPQMGDTVRWQ
VAPAVSGEGADKITHVIVKPTDVGLDTNMVIPTNRRTYYLRLVSDKKNYVTSIGFTYPDTQAKQWAAYQA
QQAKKAAVVVDKPAVSVDQLDFNYTVKSVKGMGMVPVRIFNDGQKVFIQMPTDMQEAPALFIVGQDGKDQ
LVNYRLRDGYFIVDRLFHQAALIAGVGDDQSRITITHHDHRVIEKAKSDKNWFLDYED
 
Nucleotide Sequence: 1017 bp     [Download]
>gi|261854630|ref|NC_013422.1|:1792655-1793671 Halothiobacillus neapolitanus c2 chromosome, complete genome
ATGAATAAACCCATTTTGATTCGCGGCCGCATGTTATCGCCACTCGCAAGGGCTGTGGCTATCGGCATTG
CCTTGTCCGTCACTTCGGTGGCGTTCGCCGAACCAGTCGTGCCCGCGATTGAGCACGGCGGCGCTGAGAC
ACGACCATCTCAGGCGAATACGGTGGCGATGCCGAGACACTTAAACCTCACCCCGATTCCAATCCCTCAC
CCCGCCGTGATGGCCAGCACGATGAGTGAGCGGTTTTTGCAAAACCCCAAGGCCATTCCAGCTCAAGGTA
ATAACGGGCAAGTCACTTTTGTGTACGGTCAAAGCGTGCCCACCATCACCTGTGCTCCGCTGCGGATTTG
CGACATTAGCCTTGAGCCCGGCGAGGTGATTAATGGGGCGCCGCAAATGGGCGATACCGTGCGTTGGCAA
GTGGCACCCGCCGTTTCCGGTGAAGGGGCTGACAAAATCACGCATGTGATTGTTAAACCCACCGATGTTG
GGCTGGACACCAATATGGTGATCCCCACCAATCGGAGAACTTATTACCTGCGCTTGGTTTCCGACAAGAA
GAATTATGTGACCAGCATTGGCTTCACCTACCCAGATACGCAAGCCAAGCAATGGGCGGCGTATCAAGCG
CAGCAAGCCAAGAAAGCCGCTGTTGTTGTAGATAAGCCTGCCGTTTCTGTCGATCAGCTCGACTTCAATT
ACACGGTTAAAAGCGTGAAGGGTATGGGCATGGTGCCGGTACGCATTTTCAACGATGGTCAGAAGGTATT
TATCCAGATGCCAACGGATATGCAGGAAGCACCTGCTCTGTTTATCGTCGGGCAGGATGGCAAGGATCAA
CTCGTGAATTACCGCCTGCGTGATGGTTATTTTATCGTCGATCGATTGTTTCATCAGGCCGCGCTGATTG
CAGGCGTAGGCGACGATCAATCCCGTATCACGATCACGCATCATGACCATCGTGTTATCGAGAAAGCCAA
ATCGGACAAAAATTGGTTTCTGGATTATGAGGATTAA
 Primer design