SecReT4
Protein ID: 261876196
T4SS name [ID]VirB [416]
Gene symbol-
Locus tagD11S_2287
StrainAggregatibacter actinomycetemcomitans D11S-1
Repliconplasmid S25 [GenBank: NC_013438] [Browse all T4SS(s) in this replicon]
Location [Strand]8991..9698 [+]
ProductCmgB8
Component typeVirB8
UniProt IDD0UIP9
KEGG IDaat:D11S_2287
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 9.4e-36, Aligned region: 22..233
Protein Sequence: 235 a.a.     [Download]
>gi|261876196|ref|YP_003264494.1| CmgB8 [Aggregatibacter actinomycetemcomitans D11S-1]
MFEREKSNLSQKNKEQIEGALSYEEDKERMYKRSNKIAWSIAICSFALLPITVGLGGYFGSQIVEKVSAP
KLLSLDKSTGIMDYVTVVNKDTITELDGRENLDKFFVNNYIQLRESYTSQTIQKTYNLTQLFSSEEVADD
FRKEYDRKDSLDQVLKTGTAKVSVISITLENIGNENLATARVKVDYNDTQKTYSKNFVIRLAYEYKPSVG
LDLSERMENPVGFFVTSYQKVQESL
 
Nucleotide Sequence: 708 bp     [Download]
>gi|261876182|ref|NC_013438.1|:8991-9698 Aggregatibacter actinomycetemcomitans plasmid S25, complete sequence
ATGTTTGAGCGTGAAAAGTCGAATTTAAGCCAAAAAAACAAAGAACAAATAGAAGGGGCTTTATCTTATG
AGGAAGATAAAGAACGTATGTATAAACGCTCTAATAAAATAGCGTGGAGTATTGCTATTTGTTCTTTTGC
TTTGTTACCTATCACAGTCGGATTAGGTGGGTATTTTGGTTCTCAAATTGTTGAGAAAGTTAGCGCACCT
AAATTATTAAGCCTAGATAAATCAACGGGGATAATGGACTATGTAACCGTAGTTAATAAAGATACGATAA
CCGAATTAGACGGGCGAGAAAATTTAGATAAGTTTTTTGTAAATAACTATATTCAATTAAGAGAAAGTTA
TACATCACAAACTATTCAAAAAACCTATAATTTGACCCAACTTTTTTCAAGTGAAGAAGTTGCTGATGAC
TTCCGCAAGGAATACGACAGAAAAGACAGTTTAGATCAAGTGTTAAAAACTGGCACGGCAAAAGTTAGTG
TAATCTCAATCACGCTTGAAAATATCGGTAACGAGAATTTAGCGACTGCCCGTGTGAAAGTAGATTACAA
CGATACACAAAAAACGTATTCAAAAAACTTTGTGATCCGTTTAGCTTATGAATATAAGCCAAGTGTAGGC
TTAGATTTATCTGAAAGAATGGAAAATCCAGTAGGATTTTTTGTAACCAGTTATCAAAAAGTACAAGAAA
GTTTATAA
 Primer design