SecReT4
Protein ID: 261876199
T4SS name [ID]VirB [416]
Gene symbol-
Locus tagD11S_2290
StrainAggregatibacter actinomycetemcomitans D11S-1
Repliconplasmid S25 [GenBank: NC_013438] [Browse all T4SS(s) in this replicon]
Location [Strand]11857..12891 [+]
ProductATPase
Component typeVirB11
UniProt IDD0UIQ2
KEGG IDaat:D11S_2290
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 4.4e-61, Aligned region: 14..315
Protein Sequence: 344 a.a.     [Download]
>gi|261876199|ref|YP_003264497.1| ATPase [Aggregatibacter actinomycetemcomitans D11S-1]
MENVSLKQYTKALFGDLFDNKAITEIVINRIGEIFYEDDKGFHIGTPEECKQVTKDNCEKFANAVATFCS
QKLSESNPILGTTLPSDERIQIVIPPSVDKNQFSITIRKPMSKSLTLEQYQESGFFDDIVIGEHYRPTDY
QLAECLSKKDYLGFFRIAVESGLYNLAIAGATGSGKTTFMKACVNEIPEHERLITIEDVRELFSDKHDNI
VNLLYPSEATTSEKSVTPARLLKSCLRMKPDRILLAELRAGEAFDYINAISSGHGGSITSLHAGTKDEVI
RRLTLMTLQNETGSRLPYDTAKSIIEDTIDIIVHIGKINGKRRITSLYWKDYEKVNASLSRGEK
 
Nucleotide Sequence: 1035 bp     [Download]
>gi|261876182|ref|NC_013438.1|:11857-12891 Aggregatibacter actinomycetemcomitans plasmid S25, complete sequence
ATGGAAAACGTATCATTAAAACAATACACAAAAGCACTTTTTGGCGACTTGTTCGATAACAAGGCGATTA
CAGAAATTGTGATTAATCGTATAGGCGAGATTTTTTATGAAGATGATAAAGGTTTTCATATTGGAACGCC
CGAAGAATGTAAACAAGTTACAAAAGATAATTGTGAGAAGTTTGCTAATGCGGTTGCAACTTTTTGCAGT
CAAAAACTCAGTGAGAGCAACCCAATTTTAGGTACAACATTACCAAGTGATGAGCGTATTCAAATTGTAA
TCCCCCCGTCGGTTGATAAAAATCAATTTTCAATAACCATTCGTAAACCAATGAGCAAATCTCTTACGCT
TGAGCAGTATCAAGAAAGCGGTTTTTTTGATGATATTGTGATTGGTGAGCATTATCGCCCTACGGATTAT
CAATTAGCAGAATGTTTATCGAAAAAAGACTATTTGGGATTTTTCCGTATTGCCGTAGAAAGCGGTTTAT
ATAATTTGGCGATTGCAGGTGCGACAGGTTCAGGAAAAACAACCTTTATGAAAGCGTGCGTAAATGAAAT
CCCCGAACACGAACGCTTAATCACAATCGAAGATGTACGAGAGCTTTTTAGTGATAAGCACGACAATATC
GTAAATTTACTTTACCCAAGCGAAGCGACAACCAGTGAAAAAAGCGTAACGCCTGCACGTTTATTAAAAT
CGTGCTTGCGTATGAAACCCGACCGCATTTTATTAGCCGAATTGCGAGCAGGTGAAGCCTTTGATTATAT
CAACGCAATTTCTAGCGGACACGGTGGCAGTATTACGTCGTTACACGCAGGCACAAAAGACGAAGTGATT
AGACGGCTAACCCTAATGACTTTACAAAATGAAACAGGTTCACGCTTACCGTATGATACCGCTAAATCCA
TTATCGAAGATACGATAGATATTATCGTGCATATCGGCAAAATCAACGGTAAACGTCGTATTACAAGCCT
TTATTGGAAAGACTATGAAAAAGTTAATGCAAGTTTATCAAGAGGTGAAAAATGA
 Primer design