SecReT4
Protein ID: 261876202
T4SS name [ID]VirB [416]
Gene symbol-
Locus tagD11S_2293
StrainAggregatibacter actinomycetemcomitans D11S-1
Repliconplasmid S25 [GenBank: NC_013438] [Browse all T4SS(s) in this replicon]
Location [Strand]13706..15607 [+]
Productconjugal transfer protein TraG/VirD4
Component typeVirD4
UniProt IDD0UIQ5
KEGG IDaat:D11S_2293
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.3e-111, Aligned region: 112..575
TraG-D_C [PF12696], Evalue: 1.2e-26, Aligned region: 423..542
TrwB_AAD_bind [PF10412], Evalue: 1e-21, Aligned region: 334..548
Protein Sequence: 633 a.a.     [Download]
>gi|261876202|ref|YP_003264500.1| conjugal transfer protein TraG/VirD4 [Aggregatibacter actinomycetemcomitans D11S-1]
MSNLTKEQKTAIKVFIPIVVFGIYALSVCVLIAMLSDLGNGNVFTKLNNAIQFIQSRYSLTLPFKAIGQG
FILEPILAFLMTTIFLVFVGFALHIGAKQAKKQREIFGKAEWSGEAEIRKNGLRDTKGIIVGKDNKGKFL
IFGGQQFASVGAPTRSGKGVGIVIPNLLTWENSLIVLDVKQECFSITSKYREQGLGQKVFLFDPFSFNTH
RYNPLEYLDFNAPDIELQIQGLANSLYPAGKGGKDFFILQAQAVFVSCVYLMGKLNQIDLLGSSFTLTSL
AGALQGIKVQMWDSEKERFVVNTYPLQETVETAKRMGLLSDTIYAKFLSFFDQMEAKDQFTGVKASFETP
LKVFQDPLFEMATSTNDFDFRDLRKEKITIYIGITPENISTARPILNLMFSQLIYENIRQGLPDTNPDLK
HGILMLMDEFTSIGFMEQYQVAIAYMAGYNIRSLIIYQNQTQLAENPPLGYGDKGSQTLLENHSCNIIYR
PKNPKTAEEISKRIGNITIINKNKSHNKGGTSTSDNTTQRALVLPQEIMDLKDDEEIIFCNSAKIKCKKA
FFYNDPFFIDRLKLVSPSLKDLGDKIPTKEQLDNAYQRKECQIELPNQYEAYQAQQREKAQMEAENVEIH
DLL
 
Nucleotide Sequence: 1902 bp     [Download]
>gi|261876182|ref|NC_013438.1|:13706-15607 Aggregatibacter actinomycetemcomitans plasmid S25, complete sequence
TTGAGTAATTTAACGAAAGAACAAAAAACCGCAATTAAGGTATTTATTCCTATTGTTGTATTTGGGATTT
ATGCTTTATCGGTTTGTGTATTAATCGCAATGTTGAGTGATTTAGGTAATGGCAACGTTTTTACTAAACT
CAATAATGCTATACAGTTTATTCAATCCCGTTATTCTTTAACCCTACCTTTTAAAGCAATCGGGCAAGGC
TTTATTTTAGAGCCTATTTTAGCTTTCCTGATGACAACTATTTTTCTTGTTTTCGTCGGTTTTGCTTTGC
ATATCGGAGCAAAACAAGCCAAAAAGCAACGTGAGATTTTTGGTAAAGCAGAATGGAGCGGTGAAGCGGA
AATAAGAAAAAACGGCTTGCGTGATACTAAAGGAATTATTGTAGGAAAAGACAATAAGGGCAAGTTCTTA
ATATTTGGCGGACAACAATTTGCAAGTGTTGGTGCACCGACCCGAAGCGGTAAAGGGGTAGGGATTGTAA
TACCTAACCTTTTGACGTGGGAAAATTCTTTAATTGTGTTGGACGTAAAGCAGGAATGTTTTTCGATTAC
GTCTAAATATCGAGAACAAGGATTAGGGCAAAAAGTTTTTTTATTTGATCCATTTAGTTTTAATACGCAC
CGTTATAATCCATTGGAATATTTAGATTTCAATGCCCCCGATATTGAATTACAAATACAAGGTTTAGCCA
ATTCACTTTATCCCGCAGGCAAAGGCGGTAAAGATTTCTTTATATTGCAGGCTCAAGCCGTTTTTGTATC
TTGTGTTTATTTAATGGGTAAATTAAATCAAATAGATTTATTAGGCAGTAGTTTTACTTTAACCAGTCTT
GCAGGAGCGTTACAAGGTATTAAGGTTCAAATGTGGGATAGTGAAAAAGAGCGTTTTGTTGTGAATACTT
ACCCCTTACAAGAAACGGTTGAAACGGCAAAAAGAATGGGATTATTAAGCGATACCATTTACGCAAAATT
CCTATCGTTTTTCGATCAAATGGAAGCAAAAGACCAATTTACTGGTGTTAAAGCGAGTTTTGAAACCCCG
TTAAAAGTATTCCAAGATCCATTATTTGAAATGGCAACCAGTACGAACGATTTTGACTTTAGGGATTTAC
GCAAAGAAAAAATAACTATTTATATTGGGATTACGCCCGAAAATATCAGTACCGCACGCCCAATATTAAA
TTTAATGTTTAGCCAGTTGATTTATGAAAATATCCGACAAGGCTTACCCGATACTAACCCTGATTTAAAG
CACGGGATTTTAATGTTAATGGACGAGTTTACGTCGATTGGTTTTATGGAACAATACCAAGTAGCGATAG
CCTATATGGCAGGTTACAACATCAGAAGTTTGATTATTTACCAAAATCAAACTCAATTAGCCGAAAATCC
GCCATTAGGTTATGGCGATAAAGGTAGTCAAACGCTTTTAGAAAACCATTCGTGCAACATTATTTATCGC
CCGAAAAACCCAAAAACCGCAGAAGAAATCAGTAAACGGATCGGAAACATTACAATTATTAATAAAAATA
AATCACATAATAAAGGCGGAACAAGTACAAGTGATAATACGACACAAAGGGCATTAGTATTACCGCAGGA
AATAATGGATTTAAAAGATGATGAAGAAATTATCTTTTGTAATTCAGCCAAGATAAAATGCAAAAAAGCC
TTTTTCTACAATGACCCGTTTTTTATTGACCGCTTGAAGTTGGTATCGCCAAGTTTAAAAGATTTAGGCG
ATAAAATTCCAACAAAAGAACAATTAGACAATGCTTATCAACGTAAGGAATGTCAAATTGAATTACCTAA
CCAATATGAAGCCTATCAAGCTCAACAGCGAGAAAAGGCTCAAATGGAAGCCGAAAACGTGGAAATACAC
GATTTATTATAG
 Primer design