SecReT4
Protein ID: 261888758
T4SS name [ID]Tra_F [86]
Gene symboltraL
Locus tagpSLTBT_p086
StrainSalmonella enterica subsp. enterica serovar Typhimurium plasmid pSLT-BT (NC_013437)
Repliconplasmid pSLT-BT [GenBank: NC_013437] [Browse all T4SS(s) in this replicon]
Location [Strand]82798..83109 [+]
Productconjugal transfer pilus assembly protein TraL
Component typeTraL_F
UniProt IDD0R7D8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 7.8e-38, Aligned region: 9..103
Protein Sequence: 103 a.a.     [Download]
>gi|261888758|ref|YP_003264447.1| conjugal transfer pilus assembly protein TraL [Salmonella enterica subsp. enterica serovar Typhimurium]
MSGDENKLRKYRFPETLTNQSRWFGLPVDELIPAAVCIGWGLMTSKQLFGISAAVLVYFWIRKLKKGRGS
SWLRDLIYWYMPTALLRGIFHNVPDSCFRQWIK
 
Nucleotide Sequence: 312 bp     [Download]
>gi|261888681|ref|NC_013437.1|:82798-83109 Salmonella enterica subsp. enterica serovar Typhimurium plasmid pSLT-BT, complete sequence
ATGTCGGGAGACGAGAATAAACTCAGGAAATATCGTTTCCCGGAAACACTGACCAACCAGAGCCGCTGGT
TTGGCCTGCCGGTGGATGAATTAATTCCTGCTGCTGTCTGTATTGGCTGGGGATTAATGACATCAAAACA
ACTTTTCGGCATCAGCGCTGCGGTTCTGGTTTATTTCTGGATAAGAAAACTGAAAAAAGGGCGGGGAAGC
TCCTGGCTGCGTGACCTGATTTACTGGTATATGCCGACAGCCCTGCTTCGCGGTATTTTTCATAACGTTC
CCGATTCGTGTTTCCGGCAGTGGATTAAGTAA
 Primer design