SecReT4
Protein ID: 261888777
T4SS name [ID]Tra_F [86]
Gene symboltraF
Locus tagpSLTBT_p105
StrainSalmonella enterica subsp. enterica serovar Typhimurium plasmid pSLT-BT (NC_013437)
Repliconplasmid pSLT-BT [GenBank: NC_013437] [Browse all T4SS(s) in this replicon]
Location [Strand]96469..97221 [+]
Productconjugal pilus assembly protein TraF
Component typeTraF_F
UniProt IDD0R7F7, E0D8H9, H3JTA4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 3e-74, Aligned region: 26..240
Protein Sequence: 250 a.a.     [Download]
>gi|261888777|ref|YP_003264466.1| conjugal pilus assembly protein TraF [Salmonella enterica subsp. enterica serovar Typhimurium]
MMRKIQTVWVAALLCGSLTAYGKDAGWQWYNDPVKLPDPKTTDKSAQVRQEPDIMQKLSALQTATKRALY
EAILYPGVDNFVKYFRLQNYWTQQAGLFSMSAKKAMLAHPELDYNLQYSHYNGTVRNQLAADQAQQRQAI
SKLAEHYGIMFFYRGQDPIDGQLAQVINGFRATYGLSVIPVTVDGVINPMLPDTRPDQGQAQRLGVKYFP
AMMLVDPKQGSVRPLSYGFITQDDLAKQFLNVSEDFKPNF
 
Nucleotide Sequence: 753 bp     [Download]
>gi|261888681|ref|NC_013437.1|:96469-97221 Salmonella enterica subsp. enterica serovar Typhimurium plasmid pSLT-BT, complete sequence
ATGATGCGAAAAATACAGACCGTATGGGTGGCAGCGTTACTCTGTGGCTCCCTGACGGCATACGGAAAAG
ATGCCGGATGGCAGTGGTATAACGACCCGGTAAAATTACCTGACCCAAAAACGACGGATAAATCCGCTCA
GGTTCGTCAGGAGCCTGACATTATGCAGAAATTATCTGCGCTGCAGACCGCAACAAAGCGGGCGCTTTAT
GAAGCCATTCTGTATCCCGGCGTGGATAATTTTGTGAAATATTTCCGGCTGCAGAATTACTGGACGCAGC
AGGCGGGGCTTTTCAGCATGAGCGCCAAAAAAGCCATGCTGGCGCATCCTGAACTGGACTATAACCTGCA
GTACAGCCACTACAACGGCACGGTACGTAACCAGCTGGCCGCAGACCAGGCTCAGCAACGGCAGGCCATA
TCAAAGCTGGCTGAACACTACGGTATCATGTTCTTTTACCGCGGGCAGGACCCCATTGACGGCCAGCTGG
CGCAGGTGATTAATGGCTTTCGCGCCACTTACGGTCTGAGCGTTATCCCGGTGACCGTGGACGGGGTGAT
TAACCCGATGCTGCCGGATACGCGTCCTGACCAGGGGCAGGCGCAGCGTCTTGGTGTGAAATATTTCCCG
GCCATGATGCTGGTAGACCCGAAACAGGGCAGTGTCCGTCCGTTGTCATACGGGTTTATTACGCAGGACG
ACCTGGCAAAACAGTTCCTGAATGTGTCAGAAGATTTTAAGCCGAATTTCTAA
 Primer design