SecReT4
Protein ID: 261888778
T4SS name [ID]Tra_F [86]
Gene symboltraQ
Locus tagpSLTBT_p106
StrainSalmonella enterica subsp. enterica serovar Typhimurium plasmid pSLT-BT (NC_013437)
Repliconplasmid pSLT-BT [GenBank: NC_013437] [Browse all T4SS(s) in this replicon]
Location [Strand]97435..97728 [+]
Productconjugal transfer pilin chaperone TraQ
Component typeTraQ_F
UniProt IDD0R7F8, H9L4J7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraQ [PF09679], Evalue: 6.5e-49, Aligned region: 1..97
Protein Sequence: 97 a.a.     [Download]
>gi|261888778|ref|YP_003264467.1| conjugal transfer pilin chaperone TraQ [Salmonella enterica subsp. enterica serovar Typhimurium]
MRKYKLSLPLPDITGVWVFSLGVWFHIVGRLVYRKPWMAFFLAELIAIILVLSGAYRVLDAWIARVSREE
RALLEARQAAILAAEKEEKGDKSHVSQ
 
Nucleotide Sequence: 294 bp     [Download]
>gi|261888681|ref|NC_013437.1|:97435-97728 Salmonella enterica subsp. enterica serovar Typhimurium plasmid pSLT-BT, complete sequence
GTGCGTAAATATAAATTATCGCTTCCTTTACCGGATATTACTGGAGTATGGGTTTTCTCCCTGGGCGTCT
GGTTTCACATTGTCGGGCGGCTGGTTTACCGCAAACCCTGGATGGCTTTTTTTCTGGCGGAACTGATTGC
CATCATTCTGGTGTTGTCCGGCGCTTACCGGGTGCTGGATGCCTGGATAGCCCGCGTCAGCCGGGAAGAG
CGTGCGTTACTGGAAGCCCGTCAGGCTGCCATTCTGGCTGCTGAAAAAGAAGAAAAGGGGGATAAATCAC
ATGTCTCTCAATAA
 Primer design