SecReT4
Protein ID: 261888787
T4SS name [ID]Tra_F [86]
Gene symboltraX
Locus tagpSLTBT_p115
StrainSalmonella enterica subsp. enterica serovar Typhimurium plasmid pSLT-BT (NC_013437)
Repliconplasmid pSLT-BT [GenBank: NC_013437] [Browse all T4SS(s) in this replicon]
Location [Strand]112264..113004 [+]
Productconjugal transfer pilus acetylation protein TraX
Component typeTraX_F
UniProt IDH9L4E6, D0R7G7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraX [PF05857], Evalue: 2.3e-49, Aligned region: 30..245
Protein Sequence: 246 a.a.     [Download]
>gi|261888787|ref|YP_003264476.1| conjugal transfer pilus acetylation protein TraX [Salmonella enterica subsp. enterica serovar Typhimurium]
MTMDNATRNDSRAVRVDTRLQRLLAWSPGQRDLIKTVALLLMVADHINRILHLNQEWLFLAGRGAFPLFA
LVWGLNLSQHTHIRQSAINRLWGWAVIAQSGYFLAGFPWYEGNILFAFAVTAQALKWCEQRCLFHSAAAL
LLLTAWIPLSGTSYGVAGVLVLVICYRLYRTTDTEEHLALAACLVVAVPALNLVTSDAAAVAGLLVTGLT
VWLVSLTGKSRPRFWPADFFPVFYTCHLAALGVLAM
 
Nucleotide Sequence: 741 bp     [Download]
>gi|261888681|ref|NC_013437.1|:112264-113004 Salmonella enterica subsp. enterica serovar Typhimurium plasmid pSLT-BT, complete sequence
ATGACGATGGATAACGCCACACGTAACGATTCGCGGGCAGTCCGGGTGGATACCCGGCTGCAGCGACTGC
TGGCCTGGTCGCCGGGACAGAGAGATCTCATCAAAACCGTGGCGCTGCTGCTGATGGTGGCTGACCATAT
TAACCGTATCCTGCACCTGAACCAAGAGTGGCTGTTTCTGGCCGGGCGCGGGGCGTTTCCGCTGTTTGCC
CTGGTGTGGGGGCTGAACCTGTCCCAGCATACGCATATCCGCCAGTCTGCGATTAACCGGCTGTGGGGAT
GGGCGGTTATCGCGCAGTCCGGATATTTTCTGGCGGGATTTCCGTGGTATGAAGGGAATATTCTGTTTGC
CTTTGCGGTGACCGCGCAGGCGCTGAAGTGGTGTGAGCAGCGCTGCCTGTTTCACTCTGCGGCCGCGCTG
TTACTGCTGACGGCGTGGATACCCCTGTCCGGAACCAGCTACGGCGTTGCCGGCGTGCTGGTGCTGGTCA
TCTGTTACCGGCTGTACCGGACCACAGATACTGAAGAACATCTGGCGCTTGCGGCCTGCCTAGTGGTGGC
CGTCCCCGCGCTGAATCTGGTCACCAGTGATGCCGCGGCGGTGGCAGGACTTCTGGTGACCGGGCTGACG
GTATGGCTTGTTTCGCTGACAGGCAAATCACGGCCCCGGTTCTGGCCGGCTGATTTTTTCCCGGTATTCT
ACACCTGCCATCTGGCTGCCCTGGGCGTTCTGGCGATGTGA
 Primer design