SecReT4
Protein ID: 268318495
T4SS name [ID]VirB [451]
Gene symboltaxB
Locus tagpMAS2027_35
StrainEscherichia coli plasmid pMAS2027 (NC_013503)
Repliconplasmid pMAS2027 [GenBank: NC_013503] [Browse all T4SS(s) in this replicon]
Location [Strand]23724..25565 [-]
ProductTaxB
Component typeVirD4
UniProt IDD0QMN9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.1e-143, Aligned region: 104..573
TraG-D_C [PF12696], Evalue: 3.6e-25, Aligned region: 418..536
TrwB_AAD_bind [PF10412], Evalue: 6.6e-19, Aligned region: 333..550
Protein Sequence: 613 a.a.     [Download]
>gi|268318495|ref|YP_003292195.1| TaxB [Escherichia coli]
MIMSLKLPDKGQWAFIGLVMCLVTYYTGSVAVYFLNGKTPLYIWKNFDSMLLWRIITESNIRIDIRLTAI
PSLLSGMVSSLIVPVFIIWQLNKTDVALYGDAKFASDNDLRKSKLLKWEKENDTDILVGAYKGKYLWYTA
PDFVSLGAGTRAGKGAAIGIPNLLVRKHSLIALDPKQELWKITSKVREILLGNKVYLLDPFNSKTHQFNP
LFYIDLKAESGAKDLLKLIEILFPSYGMTGAEAHFNNLAGQYWTGLAKLLHFFINYEPSWLNEFGLKPVF
SIGSVVDLYSNIDRELILSKREELEGTNGLDENALYHLRDALTKIREYHETEDEQRSSIDGSFRKKMSLF
YLPTVRKCTDGNDFDLRQLRREDITVYVGVNAEDISLAYDFLNLFFNFVVEVTLRENPDFDPTLKHDCLM
FLDEFPSIGYMPIIKKGSGYIAGFKLKLLTIYQNISQLNEIYGIEGAKTLMSAHPCRIIYAVSEEDDAAK
ISEKLGYITTTSKSTSKSRGRSTSQGESESEARRALVLPQELGTLDFKEEFIILKGENPVKAEKALYYLD
PYFMDRLMKVSPKLASLTMELNKTKKIFGVKGLKYPSKEKMLSVGELESEVLL
 
Nucleotide Sequence: 1842 bp     [Download]
>gi|268318460|ref|NC_013503.1|:c25565-23724 Escherichia coli plasmid pMAS2027, complete sequence
GTGATTATGTCTTTAAAACTCCCAGATAAAGGCCAGTGGGCTTTTATCGGTCTGGTTATGTGTCTCGTGA
CATATTATACTGGTTCTGTTGCTGTTTACTTCCTGAACGGAAAAACGCCGCTTTATATATGGAAAAATTT
TGATTCCATGCTCCTATGGCGAATAATAACAGAGAGTAATATACGGATAGATATCAGGTTAACCGCTATC
CCCTCTCTTTTATCAGGTATGGTTTCGTCTCTCATCGTGCCTGTTTTTATTATCTGGCAACTGAATAAAA
CAGATGTTGCTCTTTATGGTGACGCGAAGTTTGCCAGTGATAATGATTTAAGAAAATCGAAACTTCTGAA
ATGGGAGAAAGAAAACGATACTGATATTCTCGTCGGGGCATATAAAGGTAAATACCTGTGGTATACCGCA
CCAGATTTTGTATCACTTGGCGCAGGAACCCGCGCAGGTAAAGGTGCCGCCATTGGTATCCCTAATCTTC
TGGTCAGAAAACACTCTCTGATTGCGTTAGATCCAAAACAGGAATTGTGGAAAATCACCAGTAAGGTGCG
TGAAATACTGCTGGGTAATAAAGTTTATCTGCTCGACCCTTTCAACAGTAAAACACACCAGTTTAATCCC
CTTTTCTATATTGATTTAAAAGCGGAGAGTGGGGCTAAGGATCTGCTTAAACTGATTGAAATTCTGTTTC
CGTCTTATGGCATGACAGGGGCAGAAGCGCACTTTAATAATCTTGCGGGTCAATACTGGACAGGACTGGC
TAAGTTGCTTCATTTCTTTATTAACTATGAGCCGTCCTGGCTTAATGAGTTCGGGCTTAAACCCGTTTTC
TCAATCGGTTCTGTCGTCGACTTGTACAGCAATATTGACCGGGAACTGATACTCAGTAAGCGGGAAGAAC
TGGAGGGAACAAACGGGCTTGATGAAAACGCGTTGTATCATTTGCGCGATGCCCTGACCAAAATCAGGGA
ATATCACGAAACGGAAGATGAACAGCGTTCAAGCATTGATGGTTCTTTCCGTAAGAAAATGAGCCTGTTT
TATCTCCCAACCGTTCGTAAATGTACTGATGGTAATGATTTCGATCTCCGTCAGTTGCGACGGGAAGATA
TCACTGTTTATGTCGGTGTTAATGCGGAAGATATATCTCTGGCTTACGATTTTCTGAACCTGTTTTTCAA
CTTCGTTGTTGAAGTGACATTGCGTGAAAATCCTGATTTTGATCCCACCCTGAAACATGACTGCCTGATG
TTTCTTGATGAGTTCCCTTCGATTGGTTATATGCCAATTATTAAAAAGGGATCAGGGTATATTGCAGGTT
TTAAACTTAAACTGCTGACGATTTATCAAAATATCAGTCAGCTAAATGAAATCTATGGTATTGAGGGAGC
CAAAACGCTGATGAGTGCTCATCCATGCCGTATTATCTATGCTGTCAGCGAAGAGGATGATGCCGCGAAG
ATATCAGAAAAACTTGGATATATTACCACTACATCAAAGAGCACAAGCAAGAGCCGTGGACGGTCAACAT
CACAGGGCGAATCAGAAAGTGAAGCCCGAAGAGCACTGGTGCTTCCACAGGAGCTGGGAACGCTGGACTT
TAAAGAAGAGTTTATCATCCTGAAGGGGGAGAACCCTGTTAAAGCAGAAAAGGCACTTTATTACCTTGAT
CCGTATTTTATGGACAGATTAATGAAGGTCAGTCCTAAACTGGCATCATTGACGATGGAACTAAATAAGA
CGAAAAAAATATTTGGTGTGAAAGGGCTTAAATATCCGTCAAAAGAAAAAATGCTCTCCGTAGGAGAACT
GGAGTCTGAGGTTTTATTATGA
 Primer design