SecReT4
Protein ID: 268318496
T4SS name [ID]VirB [451]
Gene symbolpilX11
Locus tagpMAS2027_36
StrainEscherichia coli plasmid pMAS2027 (NC_013503)
Repliconplasmid pMAS2027 [GenBank: NC_013503] [Browse all T4SS(s) in this replicon]
Location [Strand]25562..26593 [-]
ProductPilX11
Component typeVirB11
UniProt IDD0QMP0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 2.9e-51, Aligned region: 25..312
Protein Sequence: 343 a.a.     [Download]
>gi|268318496|ref|YP_003292196.1| PilX11 [Escherichia coli]
MNNENRHLIYDVVNDYFYHWLNEIDGVTEIAVNRPGEIFIKVRGKWQWYEQKMSYSDCLSFASTLADFHD
GGSVTPEYPLRSATLPGGERVQVVIPPATEKDTVSITIRKPSGIFISHDKFIKQGFYSRVGGLSGDSIME
DNISALITSEYFERVIPESLSQGKTIVFCGGTGSGKTTFANACLEYIPHHLRCISIEDTDEAKFRFHKNH
VKLYYPAEGESKVITSASLLRSCFRMNPDRILMTEIRGAEAWDFLKASSSGHAGNITTVHESSPESAVLG
IVQRCYMNPECQNLPFNVILRRVLSNIDIIMSIKYLDDEDFRFASGIYYKQLHFDDYFRKLKE
 
Nucleotide Sequence: 1032 bp     [Download]
>gi|268318460|ref|NC_013503.1|:c26593-25562 Escherichia coli plasmid pMAS2027, complete sequence
GTGAATAACGAAAACAGACATCTGATTTATGATGTGGTCAACGATTATTTTTATCACTGGCTGAATGAGA
TTGATGGTGTCACGGAAATCGCTGTTAACCGACCAGGAGAAATATTTATAAAGGTCAGGGGAAAGTGGCA
ATGGTATGAACAAAAGATGAGTTACAGTGATTGTCTTTCTTTTGCATCCACACTGGCTGATTTTCATGAC
GGTGGTTCTGTGACTCCTGAATATCCCCTGCGTTCCGCCACGCTTCCGGGTGGAGAACGTGTTCAGGTTG
TGATCCCACCGGCAACAGAAAAAGATACTGTTTCTATAACAATCCGTAAGCCGTCAGGTATTTTTATCAG
TCATGACAAATTTATAAAACAGGGGTTTTATTCACGCGTCGGTGGTTTAAGTGGTGATTCCATTATGGAA
GATAATATTTCTGCTTTAATCACTTCCGAATATTTTGAACGGGTTATACCTGAATCACTGAGTCAGGGGA
AAACGATAGTTTTCTGTGGAGGGACGGGGTCTGGTAAAACTACCTTTGCAAATGCCTGTCTGGAATATAT
ACCGCATCATCTGCGGTGTATTTCTATTGAAGATACTGATGAAGCAAAATTCAGATTCCATAAAAACCAT
GTAAAACTTTACTATCCGGCAGAGGGTGAGAGTAAGGTTATTACCTCAGCGAGTCTTCTGCGTTCCTGTT
TTCGTATGAATCCGGACAGGATTCTGATGACAGAAATCAGGGGGGCTGAGGCATGGGATTTTCTGAAAGC
ATCGAGTTCAGGACATGCAGGAAACATCACCACCGTTCACGAAAGTAGTCCTGAATCTGCCGTGCTTGGG
ATTGTCCAGCGATGTTATATGAATCCTGAATGTCAGAATCTACCATTCAATGTCATTTTAAGACGTGTAC
TGAGTAATATTGATATTATCATGAGTATTAAATACCTTGATGATGAAGATTTTCGGTTCGCTTCCGGTAT
TTACTACAAACAACTTCATTTTGATGACTATTTCAGAAAACTGAAGGAGTGA
 Primer design