SecReT4
Protein ID: 268318497
T4SS name [ID]VirB [451]
Gene symbolpilX10
Locus tagpMAS2027_37
StrainEscherichia coli plasmid pMAS2027 (NC_013503)
Repliconplasmid pMAS2027 [GenBank: NC_013503] [Browse all T4SS(s) in this replicon]
Location [Strand]26595..27800 [-]
ProductPilX10
Component typeVirB10
UniProt IDD0QMP1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1e-48, Aligned region: 208..390
Protein Sequence: 401 a.a.     [Download]
>gi|268318497|ref|YP_003292197.1| PilX10 [Escherichia coli]
MTEQENKIPTATEIEQQLRERRQKELEQAGKTPEEEPGKPALQLGIEKLKKSRKGMIILVVGFLLLAAGV
SVYYIPSIIRSVSSGDEKPASQPLATGAAKRQTGLSEDIDPFNTAQKKTEKPEEEKVISSEKTEPPENKQ
QSFSRALDVSLDGSQAGNSSSSAGTSVSHTAASEPESDKKDEAKATAQATESAPLAKITKLPYDPNLFIP
EGTSIPCSLDRRFVSDLAGKLECTVNSDIYSASGNVKLIERGTAAKLMYKAGSLNHGQGRVFVMAYKLRT
RSKPFIDIPLVDSQAAGALGEAGASGWIDTHFSERFLGAMMVGMIPDLSQAASGIAQNNRDSQTDYTANS
RQAFADIAREAFSNSVNIPPTLYKNQGEIITLIVGQDLDFSGIYKLKMKGG
 
Nucleotide Sequence: 1206 bp     [Download]
>gi|268318460|ref|NC_013503.1|:c27800-26595 Escherichia coli plasmid pMAS2027, complete sequence
GTGACTGAACAGGAAAATAAAATCCCGACTGCAACCGAAATTGAACAGCAGCTACGGGAACGCAGACAGA
AAGAACTGGAACAGGCCGGGAAGACTCCGGAAGAAGAGCCTGGCAAGCCAGCATTGCAGCTTGGTATTGA
AAAACTTAAAAAGTCACGTAAAGGGATGATTATCCTCGTCGTGGGTTTTCTTCTGCTTGCTGCCGGTGTT
TCTGTTTATTATATCCCGTCCATTATCCGTTCTGTGTCGTCAGGGGATGAGAAACCCGCAAGTCAGCCGC
TTGCAACCGGAGCGGCTAAACGTCAGACCGGACTGAGCGAAGATATCGATCCTTTTAATACCGCACAGAA
AAAAACAGAGAAACCAGAGGAAGAAAAAGTCATTTCTTCTGAAAAGACTGAACCGCCGGAAAATAAACAG
CAGAGCTTCAGCCGTGCACTTGATGTTTCTCTTGATGGCAGCCAGGCAGGAAACAGCAGCAGTTCAGCGG
GAACGTCAGTTTCACATACTGCGGCCAGTGAGCCAGAAAGCGATAAAAAGGATGAAGCAAAAGCAACCGC
ACAGGCTACAGAATCTGCGCCACTGGCGAAAATAACGAAACTTCCATATGACCCAAATTTGTTTATCCCG
GAAGGGACATCAATTCCCTGTTCACTGGACAGGCGTTTTGTTTCTGACCTGGCGGGGAAACTGGAATGTA
CGGTCAACAGCGATATATACAGCGCCAGCGGTAATGTAAAACTTATCGAAAGAGGAACCGCCGCAAAACT
GATGTATAAGGCCGGGTCTTTAAATCATGGACAAGGGCGTGTGTTTGTTATGGCTTACAAGCTACGTACT
CGCAGTAAGCCTTTTATTGATATTCCCCTGGTTGACTCACAGGCGGCTGGCGCGTTAGGCGAAGCCGGTG
CTTCTGGTTGGATTGACACTCATTTCAGTGAACGTTTTCTTGGTGCAATGATGGTCGGGATGATACCGGA
TTTAAGTCAGGCCGCCAGTGGTATTGCACAGAACAACAGGGACAGCCAGACCGACTATACGGCAAACAGT
CGCCAGGCTTTTGCTGATATAGCACGCGAAGCATTTTCTAATAGTGTGAATATTCCGCCAACGCTTTATA
AAAATCAGGGCGAAATTATTACTCTGATTGTCGGTCAGGATCTGGATTTTTCAGGTATTTATAAACTGAA
AATGAAAGGGGGTTAA
 Primer design