SecReT4
Protein ID: 268318498
T4SS name [ID]VirB [451]
Gene symbolpilX9
Locus tagpMAS2027_38
StrainEscherichia coli plasmid pMAS2027 (NC_013503)
Repliconplasmid pMAS2027 [GenBank: NC_013503] [Browse all T4SS(s) in this replicon]
Location [Strand]27797..28726 [-]
ProductPilX9
Component typeVirB9
UniProt IDB0ZDX9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 2e-49, Aligned region: 31..285
Protein Sequence: 309 a.a.     [Download]
>gi|268318498|ref|YP_003292198.1| PilX9 [Escherichia coli]
MKMNKGALIMALLMAAHVCNAAVLPSGSRFDPRNQIVSYNPNNTTIINSAVGYTTTLVFDEDETVISART
GFPQGWAVNKEDNLVYLEVRPVKQTVQKNNTDANGNTSSESVSVALDPENELERWRTNLFVRTTKRNYSM
ELNARTFRQPEKIAFVVNYQYPQERRKEQAEIEKKRTEALARRLEEQAINRSLENAKSPRNWQYWKRVAE
GSQDISPDYAYDDGRYTWFGFSPLKKIPSVFVMNGMQETLTNPVIKQSGSFTAVGVPVDKRFVLRLGEQV
VGIENLGFGKVRLPAGDTVSPDVKKEVIQ
 
Nucleotide Sequence: 930 bp     [Download]
>gi|268318460|ref|NC_013503.1|:c28726-27797 Escherichia coli plasmid pMAS2027, complete sequence
ATGAAAATGAATAAAGGAGCGTTAATTATGGCGCTTCTGATGGCGGCGCACGTCTGTAATGCTGCTGTTC
TTCCTTCAGGCAGTCGCTTTGACCCACGCAATCAGATAGTCAGTTATAACCCCAATAATACCACCATAAT
TAACAGTGCCGTTGGATACACCACCACACTGGTATTTGATGAAGATGAAACAGTTATCAGTGCCAGAACC
GGTTTTCCGCAGGGATGGGCGGTTAATAAAGAAGATAACCTGGTATACCTGGAAGTTCGTCCTGTTAAAC
AAACTGTTCAGAAAAATAATACGGATGCAAACGGTAACACCTCTTCTGAATCCGTCAGTGTTGCTCTTGA
CCCGGAAAATGAGCTTGAACGCTGGCGAACGAATCTGTTTGTTCGCACCACGAAACGTAATTACAGCATG
GAGCTGAACGCCAGAACGTTCCGACAGCCGGAGAAAATTGCGTTTGTGGTGAATTACCAGTATCCGCAGG
AACGCCGGAAGGAACAGGCCGAAATTGAGAAGAAACGCACAGAGGCTCTTGCCAGACGCCTGGAGGAACA
GGCAATCAACCGTTCCCTGGAAAATGCGAAATCGCCCCGTAACTGGCAGTACTGGAAGCGGGTTGCTGAA
GGCAGCCAGGATATCAGCCCTGATTATGCATATGACGATGGTCGTTATACCTGGTTCGGCTTCAGTCCGT
TAAAGAAAATTCCCAGCGTCTTTGTGATGAACGGTATGCAGGAGACTCTTACCAATCCTGTGATTAAACA
GAGCGGGAGTTTTACGGCTGTTGGCGTACCGGTTGATAAGCGTTTTGTTTTACGTCTTGGTGAGCAGGTG
GTGGGGATTGAGAACCTGGGCTTCGGAAAAGTACGTTTACCAGCCGGAGATACGGTATCCCCGGATGTTA
AGAAAGAGGTGATCCAGTGA
 Primer design