SecReT4
Protein ID: 268318499
T4SS name [ID]VirB [451]
Gene symbolpilX8
Locus tagpMAS2027_39
StrainEscherichia coli plasmid pMAS2027 (NC_013503)
Repliconplasmid pMAS2027 [GenBank: NC_013503] [Browse all T4SS(s) in this replicon]
Location [Strand]28731..29444 [-]
ProductPilX8
Component typeVirB8
UniProt IDD0QMP3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2.2e-47, Aligned region: 19..234
Protein Sequence: 237 a.a.     [Download]
>gi|268318499|ref|YP_003292199.1| PilX8 [Escherichia coli]
MEFKLPGFKNKKDVTDSSVSFEEKNIALQERMNRIYKFGGIGGMLIGGLSLLALNAALPLKTTVVDAYLI
DKVTGVAERLTSVKKENLSENEAIARYFITQYIKHREGYNFFSLQHDYDYVMTYSAENVAADYNALFNSE
QAPKLVYNKAEKTAMVQDNPSVIISPSSRTDDKDIGAYIRFRLTIRDVATGQTRQEFWNVRLTYRIEPQV
EMVSGERNNNPLKFVVTSYVRDKEARG
 
Nucleotide Sequence: 714 bp     [Download]
>gi|268318460|ref|NC_013503.1|:c29444-28731 Escherichia coli plasmid pMAS2027, complete sequence
ATGGAATTTAAACTTCCCGGATTTAAAAATAAAAAAGACGTTACTGACTCATCAGTTTCGTTTGAAGAAA
AAAATATTGCACTACAGGAGAGAATGAATCGTATTTATAAATTCGGTGGTATCGGAGGCATGTTAATTGG
TGGGCTGTCTTTACTTGCATTAAATGCAGCATTACCACTGAAAACAACAGTTGTTGATGCCTACCTTATC
GATAAGGTTACAGGTGTGGCTGAACGTCTGACTTCTGTTAAAAAAGAAAATCTTTCTGAAAACGAAGCCA
TTGCCCGATATTTTATCACCCAGTATATAAAACATCGTGAAGGTTATAATTTTTTCAGTCTCCAGCATGA
TTATGATTATGTAATGACTTACAGCGCGGAGAATGTCGCGGCAGATTATAACGCATTATTTAACAGTGAA
CAGGCACCAAAACTTGTTTATAACAAAGCAGAAAAAACGGCAATGGTTCAGGATAATCCATCTGTCATAA
TTTCACCTTCGTCACGGACGGATGATAAAGATATCGGTGCGTATATTCGTTTTCGTCTGACCATCAGGGA
TGTTGCTACCGGACAAACCCGCCAGGAGTTCTGGAATGTTCGCCTGACTTATCGTATCGAACCGCAGGTT
GAAATGGTGTCAGGGGAACGTAATAACAATCCTCTTAAGTTCGTTGTAACAAGCTACGTTCGCGATAAAG
AAGCCAGAGGTTAA
 Primer design