SecReT4
Protein ID: 268318500
T4SS name [ID]VirB [451]
Gene symbolpilX7
Locus tagpMAS2027_40
StrainEscherichia coli plasmid pMAS2027 (NC_013503)
Repliconplasmid pMAS2027 [GenBank: NC_013503] [Browse all T4SS(s) in this replicon]
Location [Strand]29434..29562 [-]
ProductPilX7
Component typeVirB7
UniProt IDB0ZDY1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 42 a.a.     [Download]
>gi|268318500|ref|YP_003292200.1| PilX7 [Escherichia coli]
MKLLIVAFVTLCLAGCQASHKLPPVSGKSEPVNSAEVMQNGI
 
Nucleotide Sequence: 129 bp     [Download]
>gi|268318460|ref|NC_013503.1|:c29562-29434 Escherichia coli plasmid pMAS2027, complete sequence
ATGAAACTACTTATTGTGGCTTTCGTGACGCTTTGTCTCGCTGGTTGTCAGGCGTCACATAAACTACCGC
CCGTTTCCGGGAAAAGCGAACCTGTTAATTCTGCTGAGGTAATGCAAAATGGAATTTAA
 Primer design