SecReT4
Protein ID: 268318501
T4SS name [ID]VirB [451]
Gene symbolpilX6
Locus tagpMAS2027_41
StrainEscherichia coli plasmid pMAS2027 (NC_013503)
Repliconplasmid pMAS2027 [GenBank: NC_013503] [Browse all T4SS(s) in this replicon]
Location [Strand]29689..30822 [-]
ProductPilX6
Component typeVirB6
UniProt IDD0QMP5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 2e-32, Aligned region: 69..285
Protein Sequence: 377 a.a.     [Download]
>gi|268318501|ref|YP_003292201.1| PilX6 [Escherichia coli]
MGIVTGIPDGTDLSGNVTSPANAGGVSGFDSDFFQTTHEVIFNILNKSISGKLSEYSDVAYTLGKYGVSL
YVLWYAFTVLARKQQTPVPDFIWNICRFYIILLFVKNTGGILSSATDAIDGLKNTLAGGDPWVWMDQLWV
KVIQVATLIFDKDTSTVPVAGGIGALLTYVGGVLALLLCSIVFASAELTLLLLSVTAPIFIMCLMFGLLR
QMFNSWLQLNFSSLLVFLFAALALRAGTWQLNMALSTSIATASENNLLQTGVTSLAAGIFMAWIIWQAKS
YASQIAGVGVEGAMQGAAAMGIGAGVFGASRMARGALGMGRNAGIGAWKGLRRQEGGFGQSPGITGKTAN
LAGQGVNIGAKKLRQAAIERAKKMYGG
 
Nucleotide Sequence: 1134 bp     [Download]
>gi|268318460|ref|NC_013503.1|:c30822-29689 Escherichia coli plasmid pMAS2027, complete sequence
ATGGGGATTGTCACTGGTATACCGGATGGTACTGATTTATCAGGTAATGTAACCTCTCCCGCAAATGCGG
GAGGTGTTTCTGGATTTGATTCTGATTTTTTTCAGACAACTCATGAAGTTATATTTAATATTCTCAACAA
GAGTATATCTGGAAAATTAAGTGAATATTCAGATGTGGCTTATACTCTTGGTAAATATGGAGTTTCTCTG
TATGTTTTATGGTATGCTTTTACTGTATTAGCAAGGAAACAACAGACACCTGTACCTGATTTTATCTGGA
ATATCTGTAGGTTTTACATAATATTGCTTTTTGTTAAGAATACAGGGGGAATACTTTCATCAGCAACAGA
TGCTATTGATGGATTGAAAAATACATTGGCAGGGGGAGATCCGTGGGTATGGATGGATCAGTTATGGGTG
AAGGTTATACAAGTTGCAACTCTTATTTTTGATAAAGATACATCTACTGTGCCTGTTGCCGGTGGGATTG
GTGCTTTATTAACTTATGTCGGTGGTGTTTTGGCATTATTGCTTTGTTCTATAGTATTTGCATCTGCTGA
ATTAACATTACTATTACTTTCTGTCACTGCGCCAATATTTATCATGTGTCTGATGTTTGGTTTACTTCGG
CAAATGTTTAATAGCTGGCTACAGCTTAATTTTAGCTCGTTACTGGTTTTTCTATTTGCAGCATTAGCAC
TAAGAGCTGGGACATGGCAATTAAACATGGCATTAAGTACGTCTATTGCTACAGCATCAGAAAACAATCT
TCTTCAAACGGGAGTAACTTCATTAGCTGCTGGCATTTTCATGGCCTGGATTATCTGGCAGGCGAAAAGT
TATGCTTCACAGATTGCAGGTGTGGGTGTTGAAGGTGCCATGCAGGGCGCAGCCGCTATGGGGATTGGAG
CTGGCGTTTTCGGTGCATCCCGTATGGCGCGTGGCGCACTTGGTATGGGCAGAAATGCCGGTATTGGTGC
ATGGAAAGGTCTGCGTCGTCAGGAAGGCGGGTTTGGTCAGTCTCCGGGAATAACGGGTAAGACCGCTAAC
CTGGCCGGACAGGGCGTTAATATTGGTGCCAAAAAGCTTCGTCAGGCAGCTATTGAGAGGGCAAAGAAAA
TGTATGGAGGGTGA
 Primer design