SecReT4
Protein ID: 268318503
T4SS name [ID]VirB [451]
Gene symbolpilX5
Locus tagpMAS2027_43
StrainEscherichia coli plasmid pMAS2027 (NC_013503)
Repliconplasmid pMAS2027 [GenBank: NC_013503] [Browse all T4SS(s) in this replicon]
Location [Strand]31060..31818 [-]
ProductPilX5
Component typeVirB5
UniProt IDD0QMP7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 2.2e-23, Aligned region: 22..215
Protein Sequence: 252 a.a.     [Download]
>gi|268318503|ref|YP_003292203.1| PilX5 [Escherichia coli]
MKKQIMAAFVASLIVISGAQAGIPVAIDANPEWAIEAGRWTERLKQWAETVKHYENQINAYKQELLSKTG
IRDVQGLVQSAQSVSQELMQIYDQGNAFIDDYIKNPEGALSEQAKSLLSDYKVTDTCQNLGYSGDLVRGC
EATFLSQLASVEYGNKLESKLRQDNQTMKDLIDQVKNAKDTKATQDATNAVALEQLKFEKLKFQYQMYRD
KQRDLAEYKEKMAQAAFRKQQREAVPPSYRKAYMAMKSYEDD
 
Nucleotide Sequence: 759 bp     [Download]
>gi|268318460|ref|NC_013503.1|:c31818-31060 Escherichia coli plasmid pMAS2027, complete sequence
ATGAAAAAGCAAATTATGGCGGCATTCGTCGCTTCACTGATTGTTATTTCCGGCGCTCAGGCAGGGATAC
CTGTTGCCATCGACGCCAACCCTGAATGGGCGATTGAAGCCGGACGATGGACAGAACGCCTTAAGCAATG
GGCGGAAACGGTAAAACATTACGAAAATCAGATAAATGCGTACAAACAGGAGCTGCTGTCAAAAACGGGT
ATCCGTGATGTGCAGGGACTGGTGCAGTCCGCACAGTCAGTGAGTCAGGAACTGATGCAGATTTATGATC
AGGGGAATGCTTTTATTGACGATTACATTAAAAATCCTGAAGGGGCGTTATCGGAACAGGCCAAATCGTT
ATTGTCAGATTACAAAGTAACGGATACCTGCCAGAACCTGGGATATTCCGGCGACCTGGTACGGGGATGT
GAAGCGACGTTCCTTTCTCAACTGGCAAGCGTGGAATACGGTAACAAGCTGGAGAGCAAGCTTCGTCAGG
ACAACCAGACGATGAAAGACCTTATTGATCAAGTCAAAAATGCGAAGGATACGAAGGCCACGCAGGATGC
AACAAACGCTGTTGCACTTGAACAACTGAAGTTCGAGAAGCTCAAATTTCAGTATCAAATGTATCGCGAT
AAGCAGCGAGATCTTGCAGAATATAAAGAGAAGATGGCTCAGGCAGCTTTCAGAAAACAGCAACGTGAAG
CCGTGCCACCTTCTTACAGAAAAGCTTATATGGCAATGAAATCATATGAGGATGATTAA
 Primer design