SecReT4
Protein ID: 268318504
T4SS name [ID]VirB [451]
Gene symbolpilX3-4
Locus tagpMAS2027_44
StrainEscherichia coli plasmid pMAS2027 (NC_013503)
Repliconplasmid pMAS2027 [GenBank: NC_013503] [Browse all T4SS(s) in this replicon]
Location [Strand]31829..34582 [-]
ProductPilX3-4
Component typeVirB4
UniProt IDD0QMP8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 6.6e-46, Aligned region: 272..474
AAA_10 [PF12846], Evalue: 5.5e-29, Aligned region: 539..825
VirB3 [PF05101], Evalue: 1e-21, Aligned region: 2..84
Protein Sequence: 917 a.a.     [Download]
>gi|268318504|ref|YP_003292204.1| PilX3-4 [Escherichia coli]
MSTLFKGLTRPALIRGLGVPLYPFLGMCIICVLLGVWIHEAMYALILPGWYAIRRVTQFDERFFDLLYLR
TLVKGHSLSNKRFSAVHYAGSQYDEVDISKVDNFMKLKDQSSVEELIPYSSHITDNIIVTKNRDLLATWQ
IDGAYFECVDSEDLSILTDQLNTLIRSFEGKSVTLYPHRIRCKKDVRPVFNSKIPFVNRVMNDYYESFPQ
SEFFENKLFLTICFKPFTTEDKVTHFFSRGKKQKDIFKEPVNEMNEICDRLNTYLSRFHSRRLGLYEDHG
VVYSDQLSLFQYLLSGRWQKVRVSSSPFYTYLGGKDLFFGNDAGQITASDHARYFRCIEIKDYFQETDAG
ILDALMYLPVEYVVTSSFTAMDKQSAIKALDDQIDKLEMTDDAAKSLLADLKVGLDMVSSGYISFGKSHQ
TLVVFADSPERLVKDTNIVTSTLEDLGLIVTYSTLSLGAAYFAQLPGNYTLRPRLSTLSSLNFAEMESFH
NFFSGKEKGNTWGEKLITLRGSGNDIYHLNYHMTTEHQNFFGKNPTLGHTEILGTSNVGKTVLLMTKAFA
AQQFGTPESFPANRKLKKLTTVFFDKDRAGEVGIRAMGGSYYRVKEGEPTGWNPAALPPTKRNIAFMKDL
VRLLCTLNSEPLDDYQNSLISDAVERLMQRSDRSYPISKLRPLIQEPDDTETKRHGLKARLKPWTQGEEF
GWVFDNREDTFDVDNLDVFGIDGTEFLDNKVLASAASFYLIYRVTMLADGRRLLIYMDEFWQWINNEAFR
DFVYNKLKTGRKLDMVLVVATQSPDELIKSPIAAAVREQCATHIYLANPKAKRSEYVDGLQVRELYFDKI
KAIDPLSRQFLVVKNPQRKGESDDFAAFARLELGKAAYYLPVLSASKPQLELFDDIWKEGMKPEEWLDTY
LEQANLI
 
Nucleotide Sequence: 2754 bp     [Download]
>gi|268318460|ref|NC_013503.1|:c34582-31829 Escherichia coli plasmid pMAS2027, complete sequence
ATGAGTACTCTTTTTAAAGGTCTTACGCGCCCTGCTTTAATAAGGGGGCTGGGCGTTCCGCTCTACCCCT
TTCTTGGAATGTGCATTATTTGTGTTCTGCTTGGTGTCTGGATTCATGAGGCTATGTATGCCCTTATTCT
TCCTGGCTGGTATGCCATCAGGCGTGTAACACAGTTTGATGAACGCTTTTTTGACCTTCTGTATCTGAGA
ACTCTTGTCAAAGGGCATTCTTTATCAAACAAGCGATTCAGCGCAGTCCATTATGCGGGGAGCCAGTACG
ACGAAGTTGATATTTCAAAAGTGGATAACTTTATGAAGCTGAAAGACCAGTCTTCTGTTGAAGAGTTAAT
TCCGTACTCTTCACATATCACTGACAACATTATCGTTACGAAAAACCGGGATTTGCTGGCAACCTGGCAG
ATAGACGGTGCTTACTTTGAGTGTGTTGATTCTGAAGATTTGTCAATTCTGACAGATCAGCTCAATACGC
TTATACGTAGCTTTGAAGGGAAATCTGTTACGCTTTATCCTCATCGTATCAGGTGTAAAAAGGACGTCAG
ACCAGTATTTAACAGTAAAATTCCTTTTGTGAACAGAGTAATGAATGATTATTACGAGTCATTCCCTCAG
TCTGAATTTTTCGAGAATAAATTATTTCTGACGATTTGTTTTAAACCTTTTACTACGGAAGATAAAGTAA
CGCATTTCTTTTCACGAGGTAAAAAACAAAAAGATATCTTTAAAGAGCCTGTAAATGAAATGAATGAAAT
TTGCGACAGGTTGAATACCTATCTGTCCCGTTTTCATTCCCGACGTCTTGGGCTTTATGAAGATCATGGG
GTTGTTTATTCAGATCAGTTATCTCTGTTCCAGTATCTGCTTTCTGGTCGATGGCAAAAGGTCAGGGTTA
GCAGTAGTCCGTTTTATACATATCTGGGAGGAAAAGATCTGTTCTTTGGTAATGATGCCGGACAAATTAC
CGCGTCAGACCATGCCCGGTATTTTCGTTGTATAGAGATTAAGGATTATTTTCAGGAGACGGATGCCGGT
ATTCTGGATGCTCTGATGTATCTCCCCGTTGAGTATGTCGTGACATCGTCCTTTACTGCGATGGATAAGC
AGTCAGCGATTAAGGCGCTGGATGATCAGATCGATAAGCTAGAAATGACGGATGATGCTGCCAAATCTTT
GCTGGCAGATCTGAAAGTCGGACTGGATATGGTTTCCAGTGGATATATTTCTTTCGGGAAATCGCATCAG
ACCCTGGTTGTCTTTGCGGATTCACCGGAGCGTCTGGTGAAAGACACCAATATCGTGACTTCCACTCTGG
AAGATTTGGGGCTGATTGTCACTTATTCAACACTGAGTCTTGGCGCAGCTTATTTTGCTCAGCTACCAGG
AAATTATACGCTTCGCCCTCGTCTGAGTACCCTCAGTAGTCTTAATTTTGCTGAAATGGAAAGTTTTCAT
AATTTCTTTTCAGGAAAAGAAAAAGGAAATACCTGGGGGGAAAAACTGATTACTCTTCGGGGGTCAGGTA
ATGATATCTACCATCTGAATTACCATATGACGACTGAACATCAGAATTTCTTCGGTAAGAACCCGACGCT
GGGGCATACCGAAATTCTCGGTACGTCTAACGTGGGTAAAACCGTATTACTGATGACAAAAGCATTTGCC
GCCCAGCAGTTCGGTACGCCGGAATCATTCCCTGCAAACAGAAAACTGAAAAAACTGACCACGGTTTTTT
TCGATAAAGACCGGGCAGGTGAAGTCGGTATACGGGCAATGGGGGGATCTTATTACCGGGTGAAGGAGGG
AGAGCCGACAGGCTGGAATCCCGCCGCACTGCCGCCAACAAAACGTAATATCGCTTTTATGAAGGACCTG
GTGAGGCTGCTTTGTACTCTCAACAGTGAGCCGCTCGATGATTACCAGAACAGCCTGATTTCAGATGCGG
TTGAACGTCTTATGCAACGGTCAGATCGCTCTTATCCTATCAGTAAACTACGGCCTCTTATCCAGGAGCC
GGATGATACTGAAACCAAACGTCATGGACTTAAAGCCCGTCTTAAGCCGTGGACGCAGGGGGAAGAGTTT
GGCTGGGTGTTCGACAATCGGGAAGACACGTTTGATGTCGATAACCTGGATGTTTTCGGTATTGATGGAA
CGGAGTTCCTGGATAATAAGGTGCTGGCCAGTGCTGCTTCATTCTATCTCATCTATCGGGTCACTATGCT
GGCTGATGGTCGCAGGCTTCTTATCTACATGGATGAGTTCTGGCAATGGATCAATAACGAAGCGTTCAGG
GACTTTGTTTACAACAAGCTGAAAACCGGACGTAAACTCGATATGGTGCTTGTCGTAGCCACACAGTCAC
CGGATGAACTGATTAAATCACCCATTGCGGCAGCGGTTCGTGAGCAATGCGCCACTCATATCTATCTGGC
AAACCCGAAAGCCAAACGTAGTGAATATGTTGATGGTTTGCAGGTCAGGGAGCTTTATTTTGACAAAATT
AAAGCTATCGATCCGCTGTCCCGCCAGTTCCTTGTTGTTAAGAACCCACAGAGGAAAGGTGAAAGTGATG
ATTTTGCTGCTTTTGCCAGACTGGAGCTGGGAAAAGCAGCGTATTACTTACCGGTTCTCAGTGCATCAAA
ACCCCAGTTAGAACTGTTCGATGATATCTGGAAAGAAGGAATGAAGCCGGAAGAGTGGCTTGATACCTAT
CTGGAACAGGCGAACCTGATTTGA
 Primer design