SecReT4
Protein ID: 268318505
T4SS name [ID]VirB [451]
Gene symbolpilX2
Locus tagpMAS2027_45
StrainEscherichia coli plasmid pMAS2027 (NC_013503)
Repliconplasmid pMAS2027 [GenBank: NC_013503] [Browse all T4SS(s) in this replicon]
Location [Strand]34601..34930 [-]
ProductPilX2
Component typeVirB2
UniProt IDD0QMP9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 7.9e-22, Aligned region: 14..108
Protein Sequence: 109 a.a.     [Download]
>gi|268318505|ref|YP_003292205.1| PilX2 [Escherichia coli]
MALYQMKRKQKMLKLNLNKRYLTLSLFMAALMLCVAEPAFADDVSTKTTGFLQKIIDFLTDIRKPAITII
ALVIGYIAIFSRQHTSWIVPLVIGIIIFIVAPYIPDWLA
 
Nucleotide Sequence: 330 bp     [Download]
>gi|268318460|ref|NC_013503.1|:c34930-34601 Escherichia coli plasmid pMAS2027, complete sequence
GTGGCACTGTATCAAATGAAAAGGAAACAAAAGATGTTGAAATTAAATCTGAATAAACGTTATTTAACGC
TTTCTCTATTTATGGCTGCGTTGATGCTTTGTGTTGCAGAACCTGCTTTTGCGGATGATGTGTCTACGAA
GACAACTGGTTTTTTACAGAAAATAATTGATTTTTTAACGGATATTCGTAAGCCTGCAATTACAATTATT
GCTCTTGTTATTGGGTATATTGCGATATTTTCTCGTCAACATACCTCATGGATAGTCCCACTTGTTATCG
GAATTATCATCTTTATTGTTGCACCATATATTCCTGACTGGCTTGCGTAA
 Primer design