SecReT4
Protein ID: 268318506
T4SS name [ID]VirB [451]
Gene symbolpilX1
Locus tagpMAS2027_46
StrainEscherichia coli plasmid pMAS2027 (NC_013503)
Repliconplasmid pMAS2027 [GenBank: NC_013503] [Browse all T4SS(s) in this replicon]
Location [Strand]34875..35558 [-]
ProductPilX1
Component typeVirB1
UniProt IDD0QMQ0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam SLT [PF01464], Evalue: 4e-19, Aligned region: 21..151
Protein Sequence: 227 a.a.     [Download]
>gi|268318506|ref|YP_003292206.1| PilX1 [Escherichia coli]
MIAPRCSECGIFMLSTSTFLALAMQCAASVHPDTTHEVARVESGFNPYAIAEIIPKVKRKPGDKGVVSYF
PESKEAALKIVKNIELRNHRYSVGLMQITSTNFAKFGTTAEKMFDPCENLKVSEKILVDCYKRGGDLVRG
LSCYYSGNPETGVKPEPEFNNTSYVQRIGFSPPDNKKIFIVPSVKEMIKKENKTTITPEEIIIYPQYAMR
GTVSNEKETKDVEIKSE
 
Nucleotide Sequence: 684 bp     [Download]
>gi|268318460|ref|NC_013503.1|:c35558-34875 Escherichia coli plasmid pMAS2027, complete sequence
GTGATAGCGCCCCGGTGTTCTGAATGTGGAATATTTATGTTATCTACTTCTACTTTTCTTGCGCTTGCCA
TGCAATGCGCTGCCAGCGTTCATCCCGACACAACGCACGAAGTCGCCAGGGTTGAATCAGGTTTTAACCC
ATATGCAATTGCGGAAATAATACCAAAGGTTAAACGCAAACCTGGTGATAAAGGCGTAGTATCTTACTTT
CCAGAATCAAAGGAGGCAGCACTTAAGATCGTTAAAAACATTGAATTACGGAATCATCGTTACTCTGTAG
GACTTATGCAAATAACAAGTACCAATTTTGCAAAGTTCGGCACAACAGCAGAGAAAATGTTTGATCCATG
CGAAAATCTTAAGGTATCAGAAAAAATACTGGTTGACTGTTATAAACGAGGTGGCGACTTAGTGCGTGGG
CTGAGTTGCTATTATTCCGGCAATCCAGAAACAGGAGTAAAGCCAGAACCTGAATTTAATAATACAAGTT
ATGTACAACGTATAGGATTTAGCCCTCCTGATAATAAAAAAATTTTTATTGTTCCCTCTGTAAAGGAAAT
GATTAAAAAGGAGAATAAGACGACTATCACACCTGAAGAAATCATTATATATCCTCAATACGCCATGCGT
GGCACTGTATCAAATGAAAAGGAAACAAAAGATGTTGAAATTAAATCTGAATAA
 Primer design