SecReT4
Protein ID: 268507235
T4SS name [ID]Tra_F [532]
Gene symboltraX
Locus tagpEntH10407_p76
StrainEscherichia coli ETEC H10407 plasmid pEntH10407 (NC_013507)
Repliconplasmid pEntH10407 [GenBank: NC_013507] [Browse all T4SS(s) in this replicon]
Location [Strand]45141..45944 [-]
ProductF-pilin acetylation protein
Component typeTraX_F
UniProt IDD0Z6X0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraX [PF05857], Evalue: 3.7e-52, Aligned region: 51..266
Protein Sequence: 267 a.a.     [Download]
>gi|268507235|ref|YP_003294035.1| F-pilin acetylation protein [Escherichia coli ETEC H10407]
MTCRKRKPWAETDTGRQTLMTTDNTNTTRNDSLAARTDTWLQSFLVWSPGQRDIIKTVALVLMVLDHINL
IFQLKQEWMFLAGRGAFPLFALVWGLNLSRHANIRQPAINRLWGWGIIAQFAYYLAGFPWYEGNILFAFA
VAAQVLTWCETRSGWRTAAAILLMALWGPLSGTSYGIAGLLMLAVSHRLYRAEDRAERLALVACLLAVIP
ALNLATSDAAAVAGLVMTVLTVGLVSCAGKSLPRFWPGDFFPVFYACHLAVLGVLAL
 
Nucleotide Sequence: 804 bp     [Download]
>gi|268507159|ref|NC_013507.1|:c45944-45141 Escherichia coli ETEC H10407 plasmid pEntH10407, complete sequence
GTGACCTGCAGAAAGAGAAAACCCTGGGCGGAGACTGATACAGGAAGACAAACACTGATGACAACGGATA
ACACGAACACGACACGTAACGATTCACTGGCTGCACGGACCGATACCTGGTTGCAGTCATTTCTGGTCTG
GTCACCCGGACAGCGGGATATCATCAAAACGGTGGCACTGGTGCTGATGGTACTGGACCACATCAATCTG
ATATTCCAGCTGAAGCAGGAATGGATGTTTCTGGCCGGGCGAGGAGCCTTTCCGCTGTTTGCCCTGGTGT
GGGGGCTGAATCTGTCCCGTCATGCGAATATCCGGCAACCGGCCATTAACCGGCTGTGGGGATGGGGGAT
TATTGCCCAGTTCGCATATTATCTGGCCGGCTTTCCCTGGTATGAGGGGAATATCCTGTTTGCCTTTGCA
GTGGCGGCACAGGTGCTGACGTGGTGTGAAACGCGCAGTGGGTGGCGTACAGCAGCGGCCATTCTTCTGA
TGGCCCTGTGGGGGCCCTTGTCCGGCACCAGTTACGGCATTGCCGGGCTGCTGATGCTGGCAGTCAGCCA
CCGGCTGTACCGGGCGGAAGACAGAGCGGAACGTCTGGCGCTGGTCGCCTGCCTGCTGGCTGTTATTCCG
GCGCTTAACCTTGCCACCAGTGATGCAGCGGCGGTGGCTGGTCTTGTGATGACGGTGCTGACCGTTGGTC
TGGTGTCGTGTGCAGGAAAATCATTACCCCGTTTCTGGCCCGGGGATTTTTTCCCGGTATTCTACGCCTG
TCATCTGGCTGTGCTGGGCGTTCTGGCGCTGTGA
 Primer design