SecReT4
Protein ID: 268507254
T4SS name [ID]Tra_F [532]
Gene symboltraL
Locus tagpEntH10407_p95
StrainEscherichia coli ETEC H10407 plasmid pEntH10407 (NC_013507)
Repliconplasmid pEntH10407 [GenBank: NC_013507] [Browse all T4SS(s) in this replicon]
Location [Strand]64335..64646 [-]
Productconjugal transfer protein TraL
Component typeTraL_F
UniProt IDD0Z6Y9
KEGG IDelh:ETEC_p666_0330
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 4.6e-37, Aligned region: 9..103
Protein Sequence: 103 a.a.     [Download]
>gi|268507254|ref|YP_003294054.1| conjugal transfer protein TraL [Escherichia coli ETEC H10407]
MSGDENKLKKYRFPETLTNQSRWFGLPLDELIPAAVCIGWGITTSKYLFGIGAAVLVYFGIKKLKKGRGS
SWLRDLIYWYMPTALLRGIFHNVPDSCFRQWIK
 
Nucleotide Sequence: 312 bp     [Download]
>gi|268507159|ref|NC_013507.1|:c64646-64335 Escherichia coli ETEC H10407 plasmid pEntH10407, complete sequence
ATGTCGGGAGACGAGAATAAACTTAAGAAATATCGTTTCCCGGAAACACTGACCAACCAGAGCCGCTGGT
TTGGCCTGCCACTGGATGAACTGATCCCCGCAGCAGTCTGTATTGGCTGGGGTATCACAACATCAAAATA
TCTGTTCGGTATTGGTGCAGCGGTTCTGGTTTATTTCGGGATTAAAAAACTGAAAAAAGGGCGGGGCAGT
TCCTGGTTACGTGACCTGATTTACTGGTATATGCCAACAGCCCTGCTGCGCGGTATTTTTCATAATGTTC
CCGATTCGTGTTTCCGGCAGTGGATTAAATAG
 Primer design