SecReT4
Protein ID: 268593653
T4SS name [ID]VirB [215]
Gene symbol-
Locus tagETAE_p001
StrainEdwardsiella tarda EIB202
Repliconplasmid pEIB202 [GenBank: NC_013509] [Browse all T4SS(s) in this replicon]
Location [Strand]1..1938 [-]
ProductType IV secretory pathway component
Component typeVirD4
UniProt IDD0ZHL9
KEGG IDetr:ETAE_p001
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.6e-112, Aligned region: 99..550
TraG-D_C [PF12696], Evalue: 8.5e-27, Aligned region: 395..511
TrwB_AAD_bind [PF10412], Evalue: 1.1e-24, Aligned region: 138..524
Protein Sequence: 645 a.a.     [Download]
>gi|268593653|ref|YP_003297595.1| Type IV secretory pathway component [Edwardsiella tarda EIB202]
MTLNLSDAKWLKIVLLLAVPIIAIVGWAWLSGYFYLELAGLDGRAATPWTLYQYWYYYGEDKATQSWLTI
SGLGGLIVVCLPLLVIFSPAKRKLFGDAKWATTKDIAKAGLFADDGIIVGQKTSFMGLSKRFLVYGGNQH
ALMSAPTRSGKGVSVVIPTLLTWSGSTVILDLKQENWDITSGFRSAHGQDCYLLNLAPRNHRTHRWNPLY
YISDDPAFRINDIQKIGQMLFPKIDNEAPIWQSSARSLWLGIVLYLIETDELPVTMGEALRQLTMGDERL
AEIIEERQESDNPLSRECYLALKEYLDTPDKTRGSVRKGFTAALELFYNPMIDAATAENDFDLRDLRKKR
MSVYVAITPDDLDRLAPLINLFFQQVIDQNTRELPEQNPELKYQCLLLPDEFTAMGKVGILSKSISYIAG
YGLRMLPIIQSPAQLREVYGADATETFMENHALQIIFAPKNIKVAKEISETLGTTTVKNKSRTRQLVGKA
SRSENASDHSRALLLPQEVKGIGEKAEILIMENTPPIRCEKVTWYKEKVFSERGNNLKALEQGDPDAIKW
PSPEVPKLDPSSRKMGELDFRSNAVSEANRTVIERPVTAQDIENIDSLDLDNFSCDFSKIEVPKGDIDDE
AMDALVNDFFDVMAA
 
Nucleotide Sequence: 1938 bp     [Download]
>gi|268593652|ref|NC_013509.1|:c1938-1 Edwardsiella tarda EIB202 plasmid pEIB202, complete sequence
ATGACCCTGAATTTAAGCGACGCCAAATGGCTTAAAATTGTGTTACTGCTGGCTGTGCCCATTATCGCCA
TTGTTGGCTGGGCATGGCTTAGCGGCTATTTCTACCTGGAGCTGGCCGGCCTCGATGGCCGTGCCGCCAC
TCCTTGGACTCTCTATCAATATTGGTATTACTACGGCGAGGATAAGGCGACACAATCCTGGCTTACCATT
TCAGGCCTTGGGGGCCTGATAGTGGTCTGCCTTCCCCTCCTGGTGATCTTCTCACCCGCCAAGCGCAAAC
TGTTTGGCGATGCCAAATGGGCCACTACCAAGGACATTGCAAAGGCCGGTCTGTTTGCCGATGACGGCAT
CATAGTCGGCCAAAAAACGTCCTTCATGGGCCTGTCTAAACGATTCCTGGTCTACGGTGGAAACCAACAC
GCGCTTATGTCCGCACCGACGCGAAGCGGTAAGGGCGTGAGTGTGGTTATACCTACCTTGCTGACCTGGA
GCGGTTCAACCGTAATCCTCGACCTCAAACAAGAGAACTGGGATATAACGTCCGGCTTTCGCTCCGCGCA
TGGCCAGGACTGCTACCTGTTGAACCTGGCGCCTCGAAACCATCGGACCCACCGCTGGAATCCGCTCTAT
TACATCAGTGACGATCCAGCGTTCCGCATCAACGACATTCAGAAGATTGGCCAGATGCTGTTCCCGAAGA
TCGACAACGAGGCACCTATCTGGCAATCGTCGGCGCGGTCCCTGTGGCTGGGCATCGTGCTGTATCTGAT
CGAGACTGACGAGCTGCCCGTTACCATGGGCGAGGCACTGCGTCAGCTCACCATGGGCGACGAACGCCTG
GCCGAAATCATCGAAGAACGCCAGGAGAGTGATAACCCGCTGTCCCGCGAATGTTACCTGGCGCTGAAAG
AATACCTGGACACCCCGGACAAAACGCGGGGCTCAGTCCGCAAGGGCTTCACGGCCGCCCTGGAGCTGTT
CTATAACCCGATGATCGACGCCGCCACGGCAGAAAACGACTTCGACCTGCGCGACCTGCGCAAAAAGCGC
ATGTCGGTCTATGTGGCGATCACACCCGATGACCTGGACCGTCTGGCCCCTCTCATAAACCTGTTTTTCC
AGCAGGTGATCGACCAGAACACCAGGGAGCTGCCCGAGCAGAATCCCGAGCTGAAATATCAGTGCCTGTT
GCTGCCGGACGAGTTCACGGCCATGGGTAAAGTCGGCATCCTTTCCAAGAGCATCAGCTATATCGCTGGT
TATGGGCTGCGGATGCTGCCCATCATCCAGTCGCCGGCCCAGCTCCGAGAAGTCTACGGCGCCGACGCTA
CCGAAACCTTCATGGAGAACCACGCGCTTCAAATCATCTTCGCGCCGAAGAACATCAAAGTGGCCAAAGA
GATTTCGGAGACGTTGGGCACGACCACGGTCAAGAACAAGTCGCGGACTCGCCAACTGGTCGGCAAAGCC
AGCAGGTCGGAAAACGCAAGCGACCATAGCCGCGCCCTGTTGCTGCCCCAGGAAGTGAAGGGCATTGGCG
AGAAGGCGGAAATTCTCATCATGGAGAACACCCCGCCAATCCGCTGCGAGAAAGTGACCTGGTACAAGGA
GAAGGTCTTTAGCGAGCGGGGGAATAACCTCAAGGCGCTGGAGCAAGGCGACCCGGATGCCATCAAATGG
CCCAGCCCGGAAGTGCCGAAGCTGGACCCGAGCAGCCGGAAGATGGGCGAACTTGATTTTCGTTCCAATG
CTGTGTCGGAAGCCAATCGGACGGTGATCGAGCGTCCCGTTACAGCCCAGGACATTGAGAATATCGACAG
CCTGGACCTGGACAATTTCAGTTGTGACTTTTCGAAAATCGAAGTGCCGAAAGGCGACATTGACGACGAG
GCGATGGACGCCCTGGTTAATGACTTCTTCGATGTGATGGCAGCGTAG
 Primer design