SecReT4
Protein ID: 268593654
T4SS name [ID]VirB [215]
Gene symbol-
Locus tagETAE_p002
StrainEdwardsiella tarda EIB202
Repliconplasmid pEIB202 [GenBank: NC_013509] [Browse all T4SS(s) in this replicon]
Location [Strand]1904..2935 [-]
ProductType IV secretory pathway component
Component typeVirB11
UniProt IDD0ZHM0
KEGG IDetr:ETAE_p002
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 6.3e-71, Aligned region: 19..321
Mg_chelatase [PF01078], Evalue: 1.8e-05, Aligned region: 149..209
Protein Sequence: 343 a.a.     [Download]
>gi|268593654|ref|YP_003297596.1| Type IV secretory pathway component [Edwardsiella tarda EIB202]
MTSKPIDRKAVSLLEYLGVLRPFLDDADNTEIVVNKPGQVITESRKGWTYHDVPALDFACCERLAKLTAT
YSGQSLDERKPLLSATLPDGERIQIAVPPATLDGRISLTIRKPSTIDFTLQDYQEQGFFDECEDFTNELS
KDEKTLIELKEARRFKEFLELAVATKKNIIVSGSTGSGKTTFFRSLLKLVPEDERLLSIENVDELGLYKT
HQNTTSLFYSAGGQGVSPITQQQLLESSLRMKPDRIFVAELIRGDEAFYYLRNVNSGHPGSITTMHANSA
KLAIEQLVLFLKESSSGATMTREDIKQLLFMCVDIIVQIKNVRGKRVVTEIYYDPEFKRRQMA
 
Nucleotide Sequence: 1032 bp     [Download]
>gi|268593652|ref|NC_013509.1|:c2935-1904 Edwardsiella tarda EIB202 plasmid pEIB202, complete sequence
ATGACCTCAAAGCCGATTGATCGCAAAGCGGTGTCACTGCTGGAGTACCTGGGGGTACTCCGGCCCTTCC
TGGACGACGCCGATAACACCGAAATCGTGGTGAACAAGCCTGGCCAGGTGATCACCGAAAGCCGGAAAGG
CTGGACCTACCACGATGTGCCGGCATTGGACTTTGCCTGTTGTGAACGCCTGGCCAAGCTGACGGCGACC
TACTCAGGCCAAAGCCTGGACGAACGCAAGCCGTTACTGTCTGCCACGCTCCCCGATGGGGAGCGTATCC
AGATCGCGGTTCCGCCCGCGACTCTGGACGGCCGTATCAGCCTGACCATCCGAAAGCCGTCAACTATCGA
CTTCACTTTGCAGGACTACCAGGAACAGGGGTTCTTTGACGAGTGCGAGGACTTCACCAACGAGCTGAGC
AAGGACGAAAAAACCTTGATCGAGCTGAAAGAGGCCCGCCGCTTTAAGGAGTTTCTGGAGCTGGCCGTGG
CCACTAAGAAAAACATCATCGTGTCTGGCTCTACCGGGTCCGGCAAAACGACGTTTTTCCGCTCGCTGTT
GAAGCTGGTCCCGGAAGACGAACGCCTGCTGAGCATCGAGAACGTGGACGAGCTGGGCCTATACAAGACC
CATCAGAACACCACAAGCCTGTTCTATTCGGCCGGTGGCCAGGGCGTGTCTCCGATCACTCAACAACAAC
TGCTGGAAAGCAGTCTGCGGATGAAGCCGGACCGCATCTTTGTGGCCGAGCTGATCCGGGGCGATGAAGC
GTTCTATTACCTTCGCAACGTCAACAGTGGCCACCCTGGCAGCATCACCACGATGCACGCCAACAGCGCA
AAGCTGGCCATTGAACAGCTAGTGCTATTCCTCAAGGAATCAAGCAGCGGCGCGACCATGACCCGCGAAG
ACATTAAACAACTGCTTTTCATGTGCGTTGACATAATCGTGCAGATTAAAAACGTGCGGGGTAAGCGAGT
GGTAACGGAGATTTACTATGACCCTGAATTTAAGCGACGCCAAATGGCTTAA
 Primer design