SecReT4
Protein ID: 268593658
T4SS name [ID]VirB [215]
Gene symbol-
Locus tagETAE_p006
StrainEdwardsiella tarda EIB202
Repliconplasmid pEIB202 [GenBank: NC_013509] [Browse all T4SS(s) in this replicon]
Location [Strand]4980..5720 [-]
ProductType IV secretory pathway component
Component typeVirB8
UniProt IDD0ZHM4
KEGG IDetr:ETAE_p006
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2e-56, Aligned region: 21..242
Protein Sequence: 246 a.a.     [Download]
>gi|268593658|ref|YP_003297600.1| Type IV secretory pathway component [Edwardsiella tarda EIB202]
MKSDKEKKPSKAALEKQYFDEARSWDEDKTDRIQRSEKRAWRIVGAVAVIAVLEAIGLASLAPLKTVEPF
VIRVDNNTGVVDVVSTLTDTAGEVEEGAQEALDKYWLGQYIRHREGYQWETREYDRNLVGLMSSASVQQA
YAAYTDPRQNQRAPVSVYGRNTEVETNLKAISIINTETVDGETRTTALVRYTKQVKRAGERSPLTHWAAT
VTYTYLNSPMDIESRQLNPLGFQVVGYRNDQESIGG
 
Nucleotide Sequence: 741 bp     [Download]
>gi|268593652|ref|NC_013509.1|:c5720-4980 Edwardsiella tarda EIB202 plasmid pEIB202, complete sequence
ATGAAGTCCGATAAGGAAAAGAAGCCGTCCAAGGCGGCCTTGGAAAAGCAGTATTTTGACGAGGCGCGCA
GTTGGGACGAAGACAAGACAGACCGCATTCAGCGGTCGGAGAAACGGGCGTGGCGCATCGTCGGTGCTGT
CGCGGTGATTGCCGTTCTGGAAGCAATCGGGCTCGCCAGCTTGGCACCCCTGAAAACGGTGGAACCGTTT
GTTATCCGCGTCGATAACAACACTGGCGTGGTGGACGTGGTATCGACTTTGACCGATACAGCCGGCGAAG
TAGAGGAAGGCGCTCAAGAGGCTTTGGACAAATATTGGCTGGGCCAATATATCCGCCACCGCGAGGGCTA
TCAGTGGGAAACCCGCGAGTATGACCGCAACCTGGTCGGCCTCATGTCCAGCGCATCGGTTCAACAAGCC
TATGCCGCATATACCGACCCGCGCCAGAACCAGCGGGCGCCTGTTTCCGTCTACGGTCGCAACACCGAAG
TGGAAACCAACCTGAAAGCCATCAGCATCATCAACACCGAAACGGTGGACGGTGAAACGCGCACAACGGC
CCTGGTTCGATACACCAAACAGGTGAAAAGGGCAGGGGAGCGCAGCCCGCTGACCCATTGGGCGGCCACG
GTGACTTATACCTACCTGAACTCGCCAATGGACATCGAGAGCCGGCAGCTTAACCCGCTTGGCTTCCAGG
TGGTCGGCTATCGCAACGACCAGGAAAGCATCGGAGGCTGA
 Primer design