SecReT4
Protein ID: 269123649
T4SS name [ID]Trb [797]
Gene symbol-
Locus tagSmon_0882
StrainStreptobacillus moniliformis DSM 12112
Repliconchromosome [GenBank: NC_013515] [Browse all T4SS(s) in this replicon]
Location [Strand]971287..972852 [-]
Producthypothetical protein
Component typeTrbL
UniProt IDD1AYH3
KEGG IDsmf:Smon_0882
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 7.5e-12, Aligned region: 34..245
Protein Sequence: 521 a.a.     [Download]
>gi|269123649|ref|YP_003306226.1| hypothetical protein Smon_0882 [Streptobacillus moniliformis DSM 12112]
MINNFTQIFSDMLSTGVLRLVSIVLFFMTMIAMIDFILAFIFEYSADMMTFLKVFFTKIFRYTIFFAIAR
FYVPITDELVNIIFKIGYLFFPSGKIPKGRIGLPDFDEIFSFLFDSVLKIRDDWAKLHWTQFGAQLTYLI
IVLICIIGIFLIIKEIIINFVEIKVIIALGVLLLPFSVYEQTKSIGAKLWNALLNSAGKLLVSLCLTGIT
LQLLQKTTFNSNNNVNIGNAISWAFLLSLCAYLITNSKELGNMLINGTGSSNVNGVFGQALGVVVGGATA
AMGGAVVGASAVKGGLTKGMAASRGGKNLGGILKAAKSGMKEGASVSKNSRLGKIGSKFSRGMQNAVGYA
TGNRSAMNMAGDLWGATFGTASDQVMHDGERLQEQKDNIAFDSPGDAKDYISSKDRVMEAMVAVRNSLSK
NGPTPVSKLERYREAFREFREHMNNPENKEKAFEKASEIAKNKKDIYGTRKEYETARKYNPYKTDENGNR
VKKDIWNEDIGKDILRDKKENKSNDIKKEKF
 
Nucleotide Sequence: 1566 bp     [Download]
>gi|269122800|ref|NC_013515.1|:c972852-971287 Streptobacillus moniliformis DSM 12112 chromosome, complete genome
ATGATTAATAATTTTACTCAAATTTTTTCTGATATGTTATCTACTGGAGTTTTAAGACTTGTTAGCATAG
TTTTATTTTTTATGACTATGATTGCTATGATAGATTTTATCTTAGCATTTATATTTGAATATTCTGCTGA
TATGATGACTTTTTTAAAAGTATTTTTTACTAAGATATTTAGATATACTATATTTTTTGCTATTGCTAGA
TTTTATGTACCTATAACAGATGAATTAGTCAACATTATCTTTAAGATTGGTTACTTATTCTTCCCTTCTG
GAAAAATTCCAAAAGGAAGAATAGGACTACCTGATTTTGATGAAATATTTTCATTTTTATTTGATAGTGT
ACTTAAAATTAGAGATGATTGGGCTAAGTTACATTGGACACAATTTGGAGCTCAATTAACATATTTAATT
ATAGTATTAATTTGTATTATTGGAATATTTTTAATAATAAAGGAAATTATTATTAATTTTGTTGAAATTA
AGGTTATTATTGCATTAGGTGTTCTTTTACTACCATTTTCTGTATATGAGCAAACTAAAAGTATAGGAGC
TAAATTATGGAATGCTTTATTAAATTCTGCTGGTAAATTACTTGTATCTTTATGTTTAACTGGAATTACT
TTACAGTTATTACAAAAAACTACATTTAATTCAAATAATAATGTTAATATAGGGAATGCTATTTCGTGGG
CTTTTCTTTTAAGTTTATGTGCTTATCTTATAACTAATTCAAAAGAATTAGGTAATATGTTAATTAATGG
TACAGGATCAAGCAATGTAAATGGTGTATTTGGTCAAGCTTTAGGAGTTGTTGTAGGTGGAGCAACAGCA
GCTATGGGTGGTGCTGTGGTTGGAGCTTCTGCTGTTAAAGGTGGACTTACTAAAGGAATGGCAGCAAGTA
GAGGTGGTAAAAATCTTGGTGGAATATTAAAGGCTGCTAAAAGTGGAATGAAAGAAGGTGCAAGTGTTTC
TAAAAATAGTAGACTTGGAAAAATTGGATCTAAATTTTCAAGGGGAATGCAAAATGCCGTGGGATATGCA
ACTGGAAATAGAAGTGCTATGAATATGGCTGGAGATTTATGGGGAGCTACTTTTGGTACAGCTTCAGATC
AAGTAATGCATGATGGCGAAAGATTGCAAGAACAAAAAGATAATATTGCATTTGATTCTCCAGGAGATGC
TAAAGATTATATAAGTTCAAAAGATAGGGTTATGGAAGCTATGGTTGCAGTTAGAAATTCATTAAGTAAG
AATGGTCCTACTCCAGTTTCTAAATTAGAAAGATATAGAGAGGCATTTAGAGAATTTAGAGAACATATGA
ATAATCCAGAAAACAAAGAAAAGGCATTTGAAAAAGCAAGTGAAATTGCGAAAAATAAGAAGGATATATA
TGGTACTAGAAAAGAGTATGAAACTGCAAGGAAGTATAATCCTTATAAGACTGATGAAAATGGTAATAGA
GTTAAAAAGGATATTTGGAATGAGGATATTGGGAAGGATATATTGAGGGATAAAAAAGAAAATAAATCAA
ACGATATTAAAAAGGAAAAATTTTAA
 Primer design