SecReT4
Protein ID: 269123663
T4SS name [ID]Trb [797]
Gene symbol-
Locus tagSmon_0896
StrainStreptobacillus moniliformis DSM 12112
Repliconchromosome [GenBank: NC_013515] [Browse all T4SS(s) in this replicon]
Location [Strand]985305..986153 [-]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDD1AYI7
KEGG IDsmf:Smon_0896
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 2.1e-44, Aligned region: 75..282
Protein Sequence: 282 a.a.     [Download]
>gi|269123663|ref|YP_003306240.1| conjugal transfer protein TrbG [Streptobacillus moniliformis DSM 12112]
MKIFKNLTVFLLFMSLISYSNDVNKNINKLKKEVQKYEQNINKVENVDDEEIQKILKDRLAIISGKTASI
YSVSTEFNYFKSSIYQVFTKPNYTTVFKLNKDEKLVYVGGGDTENWQIDETEGGNDGATFLFVKPLIKGL
KTNLNIITDKRSYFIVLESTENNFNPYIQWKYPYENHMAHIKKMKEKREGNEIKLGKSEDIMFGFKYDKH
HKLAPEQVFTDSEKTILILSNKLQEAPVVYVYGEDNVLSLVNYRIIENKIIIDKVVNKFQLVLGNEKLDI
VR
 
Nucleotide Sequence: 849 bp     [Download]
>gi|269122800|ref|NC_013515.1|:c986153-985305 Streptobacillus moniliformis DSM 12112 chromosome, complete genome
ATGAAAATTTTTAAAAATTTAACGGTATTTTTATTATTTATGAGTTTAATTTCTTATTCAAATGATGTAA
ATAAAAATATTAATAAATTAAAAAAAGAAGTACAAAAATATGAGCAAAATATTAATAAAGTAGAAAATGT
AGATGATGAAGAAATACAAAAGATATTAAAAGATAGACTTGCAATTATATCTGGAAAAACAGCTTCAATA
TATTCAGTTTCTACAGAATTTAACTATTTTAAATCATCGATTTATCAAGTCTTTACAAAACCTAACTATA
CAACAGTTTTTAAATTAAATAAAGATGAAAAATTGGTATATGTCGGTGGTGGAGATACAGAGAATTGGCA
AATAGATGAAACTGAAGGTGGGAATGATGGTGCAACATTTTTATTTGTTAAACCATTAATTAAAGGACTT
AAAACTAATTTAAATATTATCACAGATAAGAGATCATATTTTATAGTCTTAGAATCAACAGAAAATAATT
TCAATCCATACATTCAATGGAAATATCCATATGAAAATCATATGGCACATATTAAAAAAATGAAAGAAAA
AAGAGAAGGTAATGAAATTAAATTAGGTAAAAGTGAAGATATAATGTTTGGATTTAAATATGATAAACAC
CATAAATTAGCACCAGAACAAGTATTTACTGATTCTGAAAAAACTATTTTAATACTATCTAATAAATTGC
AAGAAGCACCAGTTGTTTATGTGTATGGAGAGGATAATGTACTATCTTTAGTAAATTATAGAATAATAGA
AAATAAGATAATAATAGATAAAGTAGTAAATAAATTTCAACTCGTTTTAGGTAATGAAAAATTAGATATA
GTTAGATAA
 Primer design