SecReT4
Protein ID: 269123938
T4SS name [ID]Trb [798]
Gene symbol-
Locus tagSmon_1183
StrainStreptobacillus moniliformis DSM 12112
Repliconchromosome [GenBank: NC_013515] [Browse all T4SS(s) in this replicon]
Location [Strand]1302900..1303859 [-]
Producttype II secretion system protein E
Component typeTrbB
UniProt IDD1AV78
KEGG IDsmf:Smon_1183
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 2.2e-68, Aligned region: 26..292
Protein Sequence: 319 a.a.     [Download]
>gi|269123938|ref|YP_003306515.1| type II secretion system protein E [Streptobacillus moniliformis DSM 12112]
MTDLEISRELENEKKINFLKENLVGIEKWLNDENISEISLNQDGKIYLDIKGKGRIDSEKTLSKVDGENI
IKLVAAFSGKQITEETPIISASLPDGSRFEGLMHQVTNFSPVFSIRKHTTEVIPLEKFVETNFMTNEQKE
YIEQAIIDKKNILVVGGTSSGKTTFLNACLDKLKDSEDRISVIEEVRELKCEAKNINFFTSTETVSYRDI
LRSNMRLNPDRIILGELRTGGETIELLKAWNSGHSGGLATIHANSTLAGLKKVEQYIDEVTVKSQHYLIV
EAINVVVNIVRDGTRRYIKEIAEVVAYDKENDTYILNKK
 
Nucleotide Sequence: 960 bp     [Download]
>gi|269122800|ref|NC_013515.1|:c1303859-1302900 Streptobacillus moniliformis DSM 12112 chromosome, complete genome
ATGACTGATTTAGAAATAAGTAGAGAATTAGAAAATGAGAAAAAAATCAACTTTTTAAAAGAAAACTTAG
TGGGAATAGAAAAATGGTTAAATGATGAAAATATTAGTGAGATATCTTTAAATCAAGATGGGAAAATATA
TTTAGATATTAAAGGAAAAGGAAGAATTGATAGTGAGAAAACACTATCTAAAGTAGATGGAGAAAATATT
ATTAAATTAGTTGCTGCATTTAGTGGGAAACAAATAACTGAAGAAACACCTATTATATCTGCATCTCTTC
CTGATGGTTCAAGATTTGAAGGTTTAATGCACCAAGTAACCAATTTTTCTCCTGTATTTTCAATTAGAAA
GCATACAACAGAAGTAATACCACTTGAAAAATTTGTTGAGACAAATTTTATGACTAATGAGCAAAAAGAA
TATATAGAACAAGCTATTATTGATAAAAAAAATATATTAGTTGTTGGTGGTACATCTAGTGGTAAAACTA
CATTTTTAAATGCTTGTTTAGATAAATTAAAAGATAGTGAAGATAGAATAAGTGTTATAGAAGAGGTAAG
AGAGTTAAAGTGTGAAGCTAAAAATATTAATTTTTTTACATCAACTGAAACAGTAAGCTATAGGGATATA
TTAAGGTCAAATATGAGATTAAATCCTGATAGGATAATATTAGGAGAATTAAGAACAGGTGGAGAAACAA
TTGAGTTATTAAAAGCATGGAACTCTGGACATTCTGGTGGACTTGCAACTATACATGCTAATAGTACTTT
AGCAGGATTAAAAAAAGTAGAACAATATATTGATGAAGTAACAGTTAAATCTCAACATTATTTAATAGTT
GAAGCAATAAATGTAGTTGTAAATATAGTTAGAGATGGAACAAGAAGATATATAAAAGAGATAGCTGAAG
TAGTTGCTTATGATAAAGAAAATGATACATATATTTTAAATAAAAAATAA
 Primer design