SecReT4
Protein ID: 269123940
T4SS name [ID]Trb [798]
Gene symbol-
Locus tagSmon_1185
StrainStreptobacillus moniliformis DSM 12112
Repliconchromosome [GenBank: NC_013515] [Browse all T4SS(s) in this replicon]
Location [Strand]1304160..1306052 [-]
ProductTRAG family protein
Component typeTraG
UniProt IDD1AV80
KEGG IDsmf:Smon_1185
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 4.6e-100, Aligned region: 153..610
TraG-D_C [PF12696], Evalue: 2.2e-34, Aligned region: 459..577
TrwB_AAD_bind [PF10412], Evalue: 1.4e-24, Aligned region: 366..591
Protein Sequence: 630 a.a.     [Download]
>gi|269123940|ref|YP_003306517.1| TRAG family protein [Streptobacillus moniliformis DSM 12112]
MLSDIKKLKWKNMKSVEKRFVIGTISIIILTHILILFFYLSNYARILNYPEYFSKYILLEIDKIKIYYPN
KFMYLALSKTPNAARWAKYEYLALQVLIFIPYIILCFPIKWIPKDTSHGSARWATFDDLGLSGFLTPRIS
AKAFELNLLEDSGVVLGEVDGRLIRDNGKTHILLSAPTRTGKGVSVIIPTLVDSWKDSVFVLDIKGENYQ
MTAGWRQKEFNNTIFKFSPLSIDSCSFNPMKEVRYLTPDEIDDAKTIAQIIVIDEGSSDPFWGLAGSDLA
TTLILYELYKGKGEANLSNVVKFITDPTGPLELRLKKLINKPIFDPDRDEEILEKLLEIYTAQDDQEQIK
RGIHPFIDRGIADALGKGEKTLQSIVATAKSKLSIFESPNVEKNTSISDFRILDLMAADKPISLYIVVPP
GQIQPLAPLLRILIIQCVQLLTPEMDYSGNSNKIKFKHRLLMLLDEFPAIGKMEILEKAIGFVAGYGMKM
MLVVQSLDQLNKIYSENNMFMGNCQTQVFYTANDNKTAEYISKTIGQETVISKSVSSDGGGFFSKKNVSV
SKSGRDLIRPDEMRRFPLDKILLLVGGKPPIKSNKVLFFKDKRFKDKVKLPINPTPAMQREIELQKGSEK
 
Nucleotide Sequence: 1893 bp     [Download]
>gi|269122800|ref|NC_013515.1|:c1306052-1304160 Streptobacillus moniliformis DSM 12112 chromosome, complete genome
ATGTTAAGTGATATTAAAAAATTAAAATGGAAAAATATGAAAAGTGTTGAAAAAAGATTTGTTATTGGAA
CAATTTCTATAATTATTTTAACACATATATTAATTCTTTTTTTCTATTTATCAAATTATGCAAGGATATT
AAATTATCCAGAATATTTTAGTAAATATATATTATTAGAAATAGATAAAATAAAAATATATTACCCTAAT
AAATTTATGTATTTGGCTTTAAGTAAAACTCCTAATGCTGCAAGATGGGCAAAATATGAATATTTAGCAT
TACAAGTTTTAATATTTATTCCATATATAATACTATGTTTCCCTATAAAATGGATACCTAAGGATACATC
TCATGGTTCAGCAAGATGGGCAACATTTGATGATTTAGGATTAAGTGGATTTTTAACTCCGAGAATATCA
GCAAAAGCTTTTGAATTAAATCTATTAGAAGATAGTGGAGTTGTTTTAGGAGAAGTTGATGGAAGATTAA
TAAGAGATAATGGTAAAACACATATTCTTTTATCTGCTCCAACGAGAACAGGAAAAGGTGTTTCTGTAAT
TATTCCAACACTTGTAGATAGCTGGAAAGATTCTGTATTTGTATTAGATATTAAAGGAGAAAATTATCAG
ATGACTGCTGGGTGGAGACAAAAAGAATTTAATAATACAATTTTTAAATTTTCTCCATTATCTATAGATT
CTTGTTCATTTAATCCTATGAAAGAAGTAAGGTATCTAACTCCAGATGAAATAGATGATGCAAAAACTAT
TGCTCAAATAATAGTAATTGACGAGGGTTCATCTGATCCATTCTGGGGACTAGCTGGAAGTGATTTAGCA
ACTACATTAATTCTATATGAGCTATATAAAGGTAAGGGAGAAGCTAATTTATCAAATGTTGTTAAATTTA
TTACTGATCCTACAGGACCTTTAGAGCTTAGACTAAAAAAATTAATTAATAAACCAATATTTGATCCTGA
TAGAGATGAAGAGATTTTAGAAAAATTATTAGAAATATATACAGCTCAAGATGACCAGGAACAGATTAAA
AGAGGAATACATCCTTTTATAGATAGAGGTATTGCAGATGCTTTAGGTAAGGGAGAAAAAACATTACAAA
GTATTGTAGCAACAGCCAAATCTAAACTATCAATATTTGAATCACCTAATGTTGAAAAAAATACATCGAT
TAGTGATTTTAGGATACTAGATTTAATGGCAGCTGATAAACCTATTTCTTTATACATAGTAGTTCCACCA
GGACAAATACAACCTTTAGCACCACTTTTAAGAATACTAATTATACAATGTGTACAATTATTAACTCCAG
AAATGGATTATTCAGGAAATTCAAATAAAATTAAGTTTAAGCATAGATTATTAATGCTACTTGATGAGTT
TCCTGCTATAGGTAAAATGGAAATATTAGAAAAGGCTATAGGATTTGTGGCAGGTTATGGAATGAAGATG
ATGCTTGTTGTTCAATCTTTAGATCAATTAAATAAAATATATAGTGAAAATAACATGTTTATGGGTAACT
GTCAAACTCAAGTATTCTATACTGCAAATGATAATAAAACGGCAGAATATATATCAAAAACAATAGGGCA
AGAAACGGTTATTAGTAAAAGTGTATCAAGTGATGGTGGTGGATTTTTTAGTAAGAAAAATGTATCTGTA
TCAAAATCAGGTAGAGATTTAATTAGACCAGATGAGATGAGAAGATTCCCTTTAGATAAAATTTTATTAT
TAGTCGGTGGAAAACCACCAATTAAATCAAATAAGGTTCTATTTTTTAAAGATAAAAGATTTAAAGATAA
AGTTAAATTACCGATTAATCCAACTCCAGCAATGCAAAGGGAAATAGAATTGCAGAAAGGAAGTGAGAAA
TGA
 Primer design