SecReT4
Protein ID: 269123941
T4SS name [ID]Trb [798]
Gene symbol-
Locus tagSmon_1186
StrainStreptobacillus moniliformis DSM 12112
Repliconchromosome [GenBank: NC_013515] [Browse all T4SS(s) in this replicon]
Location [Strand]1306067..1307464 [-]
Productconjugation TrbI family protein
Component typeTrbI
UniProt IDD1AV81
KEGG IDsmf:Smon_1186
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.5e-48, Aligned region: 274..460
Protein Sequence: 465 a.a.     [Download]
>gi|269123941|ref|YP_003306518.1| conjugation TrbI family protein [Streptobacillus moniliformis DSM 12112]
MKEKNIAISVLERMNYHLDILNNQMYNVSDEEISEVKANLILDTEELVDNIKKMEEIVNKVNQNNENKTL
EKENIKEEIIREEKTNSLKNLKILFGIIALILLSIVSITIYKNVPKIEEVEEIEIADPNSFRITENDTTD
EDKPFEKIEDIEDTNFEKIIEDTIKDKDKKHEEVNLEKNISEAEVSNLDENRVEKDHEELDRAIAELENR
SHVNEVLGKKNSVEGLTFIRKSKENDDKKKEITRNRYKLNEEVENKVENIIDRKNKIASSFNDYLVQQGS
VIPAIFLTEVNTDLPGSVLAQVRENVYDSRTGNYLLIPKGSKLYGRYESNVSKGQTRVFMVWDKLSLPNG
KYIELSEFHAGDNLGNSGVSDKTNNHTWSLIGNAVLSSVLNFTDTLASGVSFNLGGLKIGLNGQSKDGKD
TSPFKEVTSHLVKKEVERQPTITIRRGYKFNIIVNGDMELEKYKY
 
Nucleotide Sequence: 1398 bp     [Download]
>gi|269122800|ref|NC_013515.1|:c1307464-1306067 Streptobacillus moniliformis DSM 12112 chromosome, complete genome
ATGAAGGAAAAGAATATAGCTATTTCTGTCTTAGAGCGAATGAATTATCATTTAGATATATTAAATAATC
AAATGTATAATGTCAGTGATGAAGAAATTTCTGAAGTTAAAGCAAATCTAATATTAGATACAGAAGAATT
AGTTGATAATATAAAGAAAATGGAAGAAATTGTTAATAAGGTTAATCAAAACAATGAAAATAAGACTTTA
GAAAAAGAAAATATAAAAGAAGAGATAATTAGAGAAGAAAAAACAAACTCATTAAAAAACTTAAAAATTC
TATTTGGAATCATAGCTTTAATACTATTATCAATTGTTAGTATAACGATTTATAAAAATGTACCTAAAAT
TGAAGAAGTGGAAGAAATAGAAATAGCTGATCCAAATAGCTTTAGAATAACTGAAAATGATACAACAGAT
GAAGATAAACCTTTTGAAAAAATAGAAGATATTGAAGATACTAATTTTGAAAAAATTATTGAAGATACTA
TTAAAGATAAAGATAAAAAACATGAAGAAGTTAATCTTGAAAAAAATATAAGTGAAGCTGAAGTAAGTAA
TTTAGATGAAAATAGAGTTGAAAAAGACCATGAAGAGCTTGATAGAGCTATAGCAGAACTTGAAAATAGA
TCGCATGTTAATGAAGTATTGGGCAAGAAAAACTCAGTGGAGGGATTAACCTTTATAAGAAAAAGTAAAG
AAAATGACGATAAGAAAAAAGAAATAACTAGAAATAGATATAAGCTTAATGAAGAAGTAGAAAATAAGGT
TGAAAATATAATTGATAGAAAAAATAAGATAGCTTCTTCATTTAACGATTATTTAGTACAACAAGGTTCG
GTAATACCTGCAATATTTTTAACAGAAGTTAATACAGATTTACCTGGTAGTGTTTTAGCACAAGTTAGAG
AAAATGTCTATGATAGTAGAACTGGAAATTACTTATTAATTCCTAAGGGTTCAAAACTTTATGGTAGATA
TGAAAGTAATGTATCTAAAGGTCAGACTAGAGTTTTCATGGTATGGGATAAATTATCATTACCTAATGGG
AAATATATAGAATTATCAGAATTTCATGCTGGAGATAATTTAGGTAATTCAGGAGTTAGTGATAAAACTA
ATAATCATACATGGTCTTTAATAGGAAATGCAGTACTTTCAAGTGTTTTAAATTTTACAGATACTTTAGC
AAGTGGAGTTAGTTTTAATTTAGGTGGTTTAAAAATTGGATTAAATGGACAATCTAAAGATGGGAAAGAT
ACATCTCCATTTAAAGAAGTTACATCACATTTAGTAAAAAAAGAAGTAGAAAGACAACCAACTATAACAA
TAAGAAGAGGATATAAATTTAATATTATAGTTAATGGAGATATGGAACTTGAAAAATATAAATATTAA
 Primer design