SecReT4
Protein ID: 269123942
T4SS name [ID]Trb [798]
Gene symbol-
Locus tagSmon_1187
StrainStreptobacillus moniliformis DSM 12112
Repliconchromosome [GenBank: NC_013515] [Browse all T4SS(s) in this replicon]
Location [Strand]1307482..1308177 [-]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDD1AV82
KEGG IDsmf:Smon_1187
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 5.5e-46, Aligned region: 24..231
Protein Sequence: 231 a.a.     [Download]
>gi|269123942|ref|YP_003306519.1| conjugal transfer protein TrbG [Streptobacillus moniliformis DSM 12112]
MQNMLKNQLSIISGKSAAVYNVSTEFNYFKSSIYQVYTKPNFTTVLKLNADENLVYVGGGDTENWQIDET
SGGSDSSTFLFVKPLFKGLKTNLNIITDKRSYFISLESTEREFNPYIQWKYPYENNMSHFKKSGLKEKNQ
EITLGKSEDISFGFKYNKNNKLAPEQVFTDKEKTILILNDKLQEAPVVYVYGEDNVLNLVNYRMIGNKII
IDKVVNKFQLVLGNEKLDITR
 
Nucleotide Sequence: 696 bp     [Download]
>gi|269122800|ref|NC_013515.1|:c1308177-1307482 Streptobacillus moniliformis DSM 12112 chromosome, complete genome
ATGCAAAATATGTTAAAAAATCAATTGTCTATAATATCAGGTAAATCTGCTGCTGTATATAATGTATCAA
CTGAATTTAACTATTTTAAATCTTCAATATATCAAGTATACACTAAACCGAATTTTACAACAGTTTTAAA
ATTAAATGCTGATGAGAATTTAGTTTATGTTGGTGGTGGAGATACAGAAAACTGGCAAATAGATGAAACA
AGTGGTGGTTCTGATTCTTCAACTTTCCTATTTGTTAAACCATTATTTAAAGGTTTAAAAACTAACCTAA
ATATTATTACAGATAAAAGGTCATACTTTATATCCCTAGAATCTACAGAAAGAGAATTTAATCCATATAT
TCAATGGAAATACCCATATGAAAATAATATGTCTCATTTTAAAAAATCAGGATTAAAAGAAAAAAATCAA
GAAATTACTTTAGGTAAGAGTGAAGACATAAGTTTTGGATTTAAATATAATAAAAATAATAAATTAGCAC
CAGAGCAAGTATTTACTGATAAAGAAAAAACAATCCTAATCCTTAATGATAAATTACAAGAAGCACCAGT
AGTATATGTTTATGGAGAAGATAATGTATTAAATTTAGTAAATTATAGAATGATAGGAAATAAAATTATT
ATTGATAAAGTAGTAAATAAATTTCAATTAGTTTTAGGAAATGAAAAATTAGATATAACTAGATAA
 Primer design