SecReT4
Protein ID: 269123945
T4SS name [ID]Trb [798]
Gene symbol-
Locus tagSmon_1190
StrainStreptobacillus moniliformis DSM 12112
Repliconchromosome [GenBank: NC_013515] [Browse all T4SS(s) in this replicon]
Location [Strand]1308846..1309550 [-]
Producthypothetical protein
Component typeTrbF
UniProt IDD1AV85
KEGG IDsmf:Smon_1190
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 4.5e-22, Aligned region: 39..231
Protein Sequence: 234 a.a.     [Download]
>gi|269123945|ref|YP_003306522.1| hypothetical protein Smon_1190 [Streptobacillus moniliformis DSM 12112]
MKENKISKMRKNFIVDESKTSRNREKIGIGIERYINISESLNTWKKAFIGMSILSLMLGGVSTFLFISKT
ETKSYLIKVNENNELVGAEKLTNQISNIGNREIEYFMKKFIKDTRTITLDKKVFDKTIKEANYFLNKETQ
SKLGSILGSENINSFFENKKTREVEILSFVAIPEVEKTYQIRWREKYYGTSGELEKRKNLNAIVKIRNFS
PNSEQIMLNPFGIIVVDFNMQVEN
 
Nucleotide Sequence: 705 bp     [Download]
>gi|269122800|ref|NC_013515.1|:c1309550-1308846 Streptobacillus moniliformis DSM 12112 chromosome, complete genome
ATGAAAGAAAATAAAATAAGTAAAATGAGAAAAAATTTTATTGTTGATGAAAGTAAGACTTCAAGAAATA
GAGAAAAAATAGGAATAGGTATAGAAAGATATATTAATATTTCTGAATCACTTAATACATGGAAGAAAGC
ATTTATTGGAATGAGTATTTTATCTTTAATGTTAGGTGGAGTTTCAACTTTTCTATTTATCAGTAAAACA
GAAACTAAAAGTTATTTAATAAAAGTAAATGAAAATAATGAATTAGTTGGAGCAGAAAAATTAACAAATC
AAATTTCTAATATTGGTAATAGAGAGATAGAATACTTTATGAAAAAATTTATTAAAGATACAAGAACTAT
TACTCTTGATAAAAAAGTATTTGATAAAACAATAAAAGAAGCAAATTATTTTTTAAATAAAGAAACACAA
TCAAAATTAGGTTCTATTTTAGGAAGTGAAAATATTAATTCATTTTTTGAAAATAAAAAAACAAGAGAAG
TAGAAATTTTATCTTTTGTTGCAATTCCAGAAGTTGAAAAAACATATCAGATTAGATGGAGAGAAAAATA
TTATGGAACTAGTGGAGAATTAGAAAAAAGAAAAAATCTAAATGCTATTGTAAAAATTAGAAACTTTTCT
CCTAACTCAGAACAAATAATGTTGAATCCTTTTGGAATAATAGTAGTTGATTTTAATATGCAGGTGGAAA
ATTAA
 Primer design