SecReT4
Protein ID: 269124254
T4SS name [ID]Tra_p [639]
Gene symbol-
Locus tagpAMbeta1_p19
StrainEnterococcus faecalis plasmid pAMbeta1 (NC_013514)
Repliconplasmid pAMbeta1 [GenBank: NC_013514] [Browse all T4SS(s) in this replicon]
Location [Strand]15049..15381 [+]
ProductAM20
Component typeOrf2_p
UniProt IDQ79A50
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 110 a.a.     [Download]
>gi|269124254|ref|YP_003305364.1| AM20 [Enterococcus faecalis]
MKKFIKDTKFKLGSAVVALGTLFITDPVFAATDPQAKLVQAGNTIKGVLTALIVVVGGIACAKIVIKYLP
SIDDPQEKNTMYKALGTALLVTALGGALVWLVPWAYGLLA
 
Nucleotide Sequence: 333 bp     [Download]
>gi|269124235|ref|NC_013514.1|:15049-15381 Enterococcus faecalis plasmid pAMbeta1, complete sequence
ATGAAAAAATTTATCAAAGATACAAAGTTTAAGCTTGGAAGTGCGGTTGTTGCGTTGGGTACATTGTTTA
TTACTGATCCAGTGTTTGCAGCCACTGATCCACAAGCAAAATTAGTTCAAGCAGGTAACACTATAAAAGG
TGTTTTAACAGCCTTAATTGTTGTAGTTGGTGGGATTGCTTGTGCAAAAATTGTTATTAAATATTTGCCG
TCTATTGATGATCCACAAGAAAAAAATACCATGTATAAAGCCTTGGGAACAGCCTTGCTTGTTACGGCAT
TAGGTGGGGCGTTGGTTTGGTTAGTACCTTGGGCGTATGGCTTACTTGCTTAA
 Primer design