SecReT4
Protein ID: 269124255
T4SS name [ID]Tra_p [639]
Gene symbol-
Locus tagpAMbeta1_p20
StrainEnterococcus faecalis plasmid pAMbeta1 (NC_013514)
Repliconplasmid pAMbeta1 [GenBank: NC_013514] [Browse all T4SS(s) in this replicon]
Location [Strand]15400..15783 [+]
ProductAM21
Component typeOrf3_p
UniProt IDD1MAV7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 127 a.a.     [Download]
>gi|269124255|ref|YP_003305365.1| AM21 [Enterococcus faecalis]
MNSDQVKQALLDLLNADTEKGRTWFFPSNVSDRYTVILGLDLKQSAKAIGTALISVLLAILIFRSTAVFP
LIIYVIVGLVSFGGVWAFYTIKPITDRPNISISDFMKQRKDFSKRPKVYYKKPKERV
 
Nucleotide Sequence: 384 bp     [Download]
>gi|269124235|ref|NC_013514.1|:15400-15783 Enterococcus faecalis plasmid pAMbeta1, complete sequence
ATGAATAGCGATCAAGTGAAACAAGCCCTATTAGATTTGTTAAATGCAGACACTGAAAAAGGGCGGACTT
GGTTTTTTCCGTCCAATGTATCTGATCGGTACACAGTCATTTTAGGGCTAGATTTAAAACAATCAGCAAA
AGCGATCGGTACGGCATTAATAAGCGTGTTATTGGCAATTCTTATTTTCCGTAGCACAGCCGTTTTTCCT
TTAATTATCTATGTCATTGTTGGTTTGGTGTCATTTGGTGGTGTATGGGCGTTTTATACGATTAAACCAA
TTACAGACCGCCCTAACATTTCTATATCTGATTTTATGAAGCAAAGAAAAGACTTTTCTAAAAGACCAAA
AGTCTATTATAAAAAGCCGAAAGAACGAGTGTAA
 Primer design