SecReT4
Protein ID: 269124257
T4SS name [ID]Tra_p [639]
Gene symbol-
Locus tagpAMbeta1_p22
StrainEnterococcus faecalis plasmid pAMbeta1 (NC_013514)
Repliconplasmid pAMbeta1 [GenBank: NC_013514] [Browse all T4SS(s) in this replicon]
Location [Strand]16440..18401 [+]
ProductAM23
Component typeOrf5_p
UniProt IDD1MAV9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.4e-40, Aligned region: 244..586
Protein Sequence: 653 a.a.     [Download]
>gi|269124257|ref|YP_003305367.1| AM23 [Enterococcus faecalis]
MEKIPKEKIIVIPEVDTDVVSDLAPFNFTVERDKLLIDDSYAVPYVITKYNNKPRGNWFNRIRKMSGDIT
ISHYYTKANGNSLNDYYNRTIKNKQAEIDRSHDPLTIIRLEREMKIAQTQLEQAVDENTSYLYLYTYVLI
KSKSEDKLKKLCEDFETRCIASGVKALIPYTMIDKAYWSALPLQSNEVPEYTYTIANSISASSIFPFDDN
ELSVFTKNMIIEGINKDTENIVSIDYTNRKLVVNRNKFVFGLSGGGKTTYLTSDYLKKYAFSDNSTELRH
RIVLFDPEDEQTERVRSLGGEIINLSSMSDVRINPFQIYSRNTLDVDLKESLSDFEEDELVENLEIKHKD
YEMTDNDIDKEISKRMNILTPYFLMVDHSLTDSQLSIIKIEAKKCYTTLYEKKNLSKMENTDFPTFSDLE
NRLKALEETDPKRYKRIEDFIYSLEDFTIGSRTIFNGHTNIDLNNPLICFSLRDLQTEEGIRDLAYLNSF
SYLFEEITNNPQIVTSVYADEFHFLLKNKISADFFFQAYKRFRKYNADCTVSTQQIDDVLKAPDNIGKAI
IGNSFTKVFFGLDETEAQGISNELKLKLTKKELSFITSKRQGEALLFHGTKRAKIKVDLTQEEMRLLNPG
EYEDIYGVSPKKEINWLLRSKIQ
 
Nucleotide Sequence: 1962 bp     [Download]
>gi|269124235|ref|NC_013514.1|:16440-18401 Enterococcus faecalis plasmid pAMbeta1, complete sequence
ATGGAGAAGATACCAAAAGAGAAAATTATTGTAATACCCGAAGTTGATACGGACGTTGTATCTGATTTAG
CACCATTTAACTTTACAGTAGAACGTGACAAATTATTAATCGATGATTCATACGCAGTTCCCTATGTCAT
TACAAAATACAATAATAAACCAAGAGGAAATTGGTTTAATCGTATTCGTAAAATGAGTGGAGATATAACC
ATATCTCATTACTACACTAAAGCAAACGGTAACTCATTGAATGATTATTACAACAGAACCATTAAGAACA
AGCAAGCAGAGATCGATCGTTCGCATGATCCGTTGACGATTATCCGTTTAGAACGTGAAATGAAAATTGC
ACAAACGCAGTTAGAACAAGCCGTTGATGAAAACACTTCTTATCTTTACTTGTATACCTATGTTTTGATT
AAAAGCAAGTCAGAAGATAAGTTGAAAAAATTGTGTGAAGATTTTGAAACACGTTGTATCGCAAGTGGAG
TAAAAGCCTTGATTCCATATACTATGATTGATAAAGCGTATTGGAGTGCCTTGCCTTTACAATCTAATGA
AGTGCCTGAATACACGTACACAATCGCAAACTCAATCAGTGCAAGTAGTATTTTTCCTTTTGATGATAAT
GAGTTAAGCGTATTTACTAAAAATATGATTATTGAGGGAATTAATAAAGATACTGAAAATATCGTTAGTA
TTGATTACACCAACAGAAAATTAGTAGTCAATCGTAATAAATTCGTTTTTGGTTTATCTGGTGGGGGAAA
GACCACTTACCTAACGTCAGACTATTTAAAAAAATATGCTTTTTCTGATAATTCAACAGAACTAAGGCAC
AGAATCGTTTTATTTGATCCCGAAGATGAACAAACAGAGCGTGTACGTTCTCTAGGGGGCGAAATAATCA
ATCTATCGTCTATGTCAGACGTCCGTATCAATCCATTTCAAATCTACTCACGCAATACGCTAGATGTCGA
TTTAAAAGAATCGTTATCCGATTTTGAAGAGGACGAACTTGTAGAAAATCTTGAAATAAAGCATAAAGAT
TATGAAATGACTGACAATGATATTGATAAAGAAATCAGTAAACGAATGAATATTTTAACGCCTTATTTCC
TAATGGTAGATCATTCTTTGACTGATAGTCAATTATCCATTATTAAAATAGAAGCGAAAAAATGCTATAC
CACTTTATACGAGAAGAAAAACTTGTCAAAAATGGAAAATACCGATTTTCCAACATTTTCAGACTTAGAA
AATCGATTGAAAGCCTTAGAAGAAACTGATCCAAAAAGATACAAACGAATTGAAGATTTTATTTATTCAT
TAGAAGATTTTACAATCGGAAGTCGTACCATTTTTAACGGTCATACAAATATAGACTTAAACAATCCGTT
AATTTGCTTTTCTTTGCGAGATTTACAGACCGAAGAAGGGATCAGAGATTTAGCATACCTCAACAGCTTT
AGTTATCTATTTGAAGAAATAACCAACAATCCGCAAATTGTAACGTCTGTTTATGCAGATGAATTTCACT
TTTTATTGAAGAATAAAATTAGTGCTGACTTTTTCTTCCAAGCATATAAACGCTTTAGAAAATACAATGC
TGATTGTACCGTATCAACCCAACAGATTGATGATGTATTAAAAGCACCTGATAATATCGGTAAAGCAATT
ATTGGGAATAGCTTTACAAAAGTATTCTTTGGACTTGATGAAACGGAAGCACAAGGTATTTCAAATGAGT
TGAAACTTAAACTCACAAAAAAAGAATTATCGTTCATTACCTCAAAACGTCAAGGGGAAGCTTTGCTTTT
TCATGGTACAAAGCGAGCAAAGATAAAAGTAGATTTAACACAGGAAGAAATGCGTTTGCTTAACCCAGGC
GAATATGAAGATATTTACGGCGTTAGTCCGAAGAAAGAGATCAACTGGTTGTTAAGATCGAAAATTCAAT
AG
 Primer design