SecReT4
Protein ID: 269124259
T4SS name [ID]Tra_p [639]
Gene symbol-
Locus tagpAMbeta1_p24
StrainEnterococcus faecalis plasmid pAMbeta1 (NC_013514)
Repliconplasmid pAMbeta1 [GenBank: NC_013514] [Browse all T4SS(s) in this replicon]
Location [Strand]19789..20898 [+]
ProductAM25
Component typeOrf7_p
UniProt IDD1MAW1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Lysozyme_like [PF13702], Evalue: 1.8e-57, Aligned region: 53..210
CHAP [PF05257], Evalue: 2.1e-31, Aligned region: 247..364
SLT [PF01464], Evalue: 4.6e-05, Aligned region: 83..158
Protein Sequence: 369 a.a.     [Download]
>gi|269124259|ref|YP_003305369.1| AM25 [Enterococcus faecalis]
MGATAAKLLIRYRKPIAKAILGFFVFIIVIFLLIFNNDQTAPSGGLATENKNLSESVLRYKSTVEKYARQ
YDGMEYVPYILALMQIESGGEGGDPMQSSESLGLPPNTIKDPERSIQRGVEFFVENMKSAINRGSDIKTA
LQAYNYGGGFVDFVVKNGGTYSFELAKQFSINMSGGEKVPYVNALSTTMGYNYRYNYGNMFYVPKLLEYV
NESQASAEGVQNNSNNTGAVQVDVPSEYKNKLRYPRYDGHNYNTSGSYPFGQCTWYAFNRMAQIGKPVDD
FMGNGGEWGYKGKALGYKVTNKPKVGTAISFPPGSFGSDPVYGHVAFVEVVNADGTLLVSECNVVNPGSG
TISYRVVPTSIANIASYVE
 
Nucleotide Sequence: 1110 bp     [Download]
>gi|269124235|ref|NC_013514.1|:19789-20898 Enterococcus faecalis plasmid pAMbeta1, complete sequence
ATGGGAGCAACAGCTGCTAAACTGCTTATTCGTTATCGAAAACCGATAGCGAAAGCAATTTTAGGCTTTT
TCGTCTTTATCATTGTAATCTTCCTTCTTATTTTTAATAACGATCAAACCGCCCCTAGTGGCGGACTAGC
AACAGAAAACAAAAATTTAAGTGAATCTGTTTTGAGGTACAAAAGTACCGTTGAAAAGTACGCTAGACAA
TATGACGGTATGGAATATGTGCCTTATATCTTAGCCCTTATGCAAATTGAATCAGGCGGTGAAGGTGGCG
ACCCTATGCAATCAAGCGAAAGTTTAGGACTGCCCCCGAACACTATTAAAGACCCCGAACGAAGCATACA
ACGAGGAGTAGAGTTTTTTGTAGAAAATATGAAAAGCGCTATAAACCGAGGATCAGATATAAAAACAGCT
CTTCAAGCGTATAATTATGGCGGTGGTTTTGTTGATTTTGTAGTGAAGAATGGCGGAACGTATTCTTTTG
AGTTGGCTAAACAATTTTCTATTAATATGTCAGGTGGCGAAAAGGTACCTTATGTAAATGCTTTATCTAC
TACAATGGGCTACAATTACCGCTATAACTACGGAAATATGTTCTATGTGCCAAAATTACTTGAATACGTT
AACGAAAGCCAGGCAAGCGCAGAGGGCGTTCAAAACAATTCTAATAATACTGGCGCTGTTCAAGTTGATG
TACCTAGTGAGTACAAAAATAAATTACGTTATCCAAGATATGATGGACACAACTATAATACCAGTGGCAG
TTATCCTTTTGGGCAATGTACTTGGTACGCTTTTAATCGTATGGCTCAAATAGGAAAACCAGTTGATGAT
TTTATGGGCAATGGTGGCGAATGGGGCTATAAAGGGAAAGCTTTAGGCTATAAAGTAACAAATAAGCCCA
AAGTAGGTACGGCAATTTCTTTCCCACCTGGTTCTTTTGGCTCTGATCCAGTTTACGGACATGTTGCCTT
TGTGGAAGTCGTAAATGCAGACGGTACGCTTTTAGTATCAGAATGTAATGTTGTAAACCCAGGAAGTGGA
ACAATCAGTTATCGAGTAGTGCCGACTTCTATTGCAAACATTGCAAGTTATGTTGAATAA
 Primer design