SecReT4
Protein ID: 269124261
T4SS name [ID]Tra_p [639]
Gene symbol-
Locus tagpAMbeta1_p26
StrainEnterococcus faecalis plasmid pAMbeta1 (NC_013514)
Repliconplasmid pAMbeta1 [GenBank: NC_013514] [Browse all T4SS(s) in this replicon]
Location [Strand]21467..21898 [+]
ProductAM27
Component typeOrf9_p
UniProt IDD1MAW3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 143 a.a.     [Download]
>gi|269124261|ref|YP_003305371.1| AM27 [Enterococcus faecalis]
MAKKKQEQVKLIVLVILYLLLLPVTLIVFKLLPFIIANDTNIELSTFVTTILKHPINTFLEIIQSTYMIP
FFIVQIIVLIVLFVFLHPTKRQPFEVVGKTNPVHGSAYWGEESEINAPKNVHLIPEKSMKSILEKSMRRG
KND
 
Nucleotide Sequence: 432 bp     [Download]
>gi|269124235|ref|NC_013514.1|:21467-21898 Enterococcus faecalis plasmid pAMbeta1, complete sequence
ATGGCGAAGAAGAAGCAAGAGCAAGTGAAACTGATTGTCCTAGTTATACTCTATCTACTATTATTACCAG
TAACATTGATTGTATTTAAATTATTACCTTTTATCATTGCGAATGATACAAATATTGAATTGAGTACCTT
TGTTACAACTATTTTAAAGCACCCGATCAATACTTTTTTAGAGATCATTCAATCTACTTACATGATCCCG
TTCTTCATTGTACAAATTATTGTTTTAATCGTTTTATTTGTCTTTCTACACCCTACCAAACGCCAACCGT
TTGAGGTTGTCGGAAAAACAAACCCTGTTCATGGCTCGGCTTATTGGGGGGAGGAATCAGAAATAAATGC
ACCAAAAAATGTTCATTTGATCCCTGAAAAATCAATGAAAAGCATATTAGAAAAGTCAATGAGGAGGGGG
AAAAATGACTAG
 Primer design