SecReT4
Protein ID: 269124262
T4SS name [ID]Tra_p [639]
Gene symbol-
Locus tagpAMbeta1_p27
StrainEnterococcus faecalis plasmid pAMbeta1 (NC_013514)
Repliconplasmid pAMbeta1 [GenBank: NC_013514] [Browse all T4SS(s) in this replicon]
Location [Strand]21891..23546 [+]
ProductAM28
Component typeOrf10_p
UniProt IDD1MAW4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 6.5e-95, Aligned region: 33..456
TraG-D_C [PF12696], Evalue: 3.2e-32, Aligned region: 289..416
TrwB_AAD_bind [PF10412], Evalue: 4.4e-16, Aligned region: 29..147
TrwB_AAD_bind [PF10412], Evalue: 4.4e-16, Aligned region: 266..418
Protein Sequence: 551 a.a.     [Download]
>gi|269124262|ref|YP_003305372.1| AM28 [Enterococcus faecalis]
MTSLLAESDGLILGKFPSGKVVIQPEDSKISNRNIFVVGGPGSFKTQSYVLPNVVNNRSTSIVVTDPKGE
IYELTNEIKKAQGFKTVVINFKDFLLSSRYNPLLYIRKSNDTNKIANVIVSAKNDPKRKDFWFNAQLNLL
NTLIKYVYFEYEPSARTIEGILDFLEEFDPRYNEEGVSELDEQFERLPDGHEAKRSYYLGFRQAQSEARP
NIVISLLTTLQDFVDKEVSEFTSTNDFFFEELGTSKICLYVLISPLDRTWDGLVNLFFQQMFTELYFLGD
KHNAKLPVPLVMLLDEFVNLGYFPTYENFLATCRGYRISVSTILQSLPQGFELYGDKKFKAIIGNHAIKI
CLGGVEETTAEYFSRQVNDTTIKVYTGGTSESKTSAKTTNRSGSKSESYGYQKRRLITEGEVINLQQEEN
GRKSIVLIDGKPYMLRKTPQFELFGNLLKKHEISQQDYISSQTEFAKEYIEELEKQHKQRKVQLASAPIF
HEKKQEDDLNKKEINLPEQPIESEVTEEEEEKELLMSDILSSFDEGIEENTTNNDNSELPF
 
Nucleotide Sequence: 1656 bp     [Download]
>gi|269124235|ref|NC_013514.1|:21891-23546 Enterococcus faecalis plasmid pAMbeta1, complete sequence
ATGACTAGTTTGTTAGCAGAATCAGACGGTTTAATATTGGGGAAATTTCCAAGTGGAAAAGTTGTGATCC
AACCCGAAGATAGCAAAATAAGCAATCGAAATATTTTTGTCGTAGGTGGTCCAGGATCATTTAAAACACA
AAGTTATGTTTTGCCTAATGTTGTAAATAATCGCAGTACGTCAATTGTTGTAACCGATCCAAAAGGGGAA
ATTTACGAGTTAACCAATGAAATAAAAAAAGCCCAGGGCTTCAAAACGGTTGTCATAAATTTTAAAGATT
TTTTACTAAGTTCTAGGTACAATCCATTACTTTACATTCGCAAATCAAATGATACAAACAAGATTGCGAA
CGTCATAGTATCAGCAAAGAATGACCCCAAACGGAAAGATTTTTGGTTCAATGCACAATTAAACTTATTA
AATACGTTGATTAAATATGTTTATTTTGAATATGAACCAAGCGCACGAACAATTGAGGGCATTTTAGACT
TTTTAGAAGAATTTGATCCACGCTATAACGAAGAAGGTGTATCAGAACTTGATGAACAATTTGAGCGGTT
GCCAGACGGACACGAAGCAAAACGCAGTTACTATTTAGGCTTCCGACAAGCACAAAGTGAAGCAAGACCA
AACATTGTTATTAGTCTATTGACGACTTTACAAGATTTTGTTGATAAAGAAGTATCAGAATTTACCAGTA
CAAACGATTTTTTCTTTGAGGAATTAGGAACGTCAAAAATTTGTTTATACGTGCTAATTTCCCCATTAGA
TCGAACTTGGGACGGCTTAGTGAATCTCTTTTTCCAACAAATGTTTACAGAGTTATATTTTTTAGGAGAT
AAGCACAACGCAAAATTGCCAGTACCTTTAGTTATGTTACTAGATGAATTTGTCAATTTGGGCTACTTTC
CAACATACGAGAATTTTCTTGCAACGTGTCGAGGGTATCGTATTTCAGTTAGTACCATATTGCAATCTTT
GCCCCAGGGCTTTGAACTTTACGGAGATAAGAAATTTAAAGCGATCATTGGGAATCATGCCATTAAAATA
TGTCTAGGTGGTGTAGAGGAAACGACTGCCGAATACTTTTCAAGACAAGTAAATGATACAACAATCAAAG
TATATACAGGCGGAACAAGTGAAAGTAAAACGTCCGCAAAAACAACTAACCGAAGCGGAAGTAAGTCAGA
AAGCTACGGTTACCAAAAAAGGCGATTGATTACCGAAGGGGAAGTTATCAATTTACAACAAGAAGAAAAT
GGCAGAAAAAGTATTGTGTTAATTGACGGTAAACCTTACATGTTAAGAAAAACGCCACAATTTGAATTGT
TCGGAAATCTTCTTAAAAAGCATGAAATTTCACAGCAAGATTATATAAGCAGTCAAACGGAATTTGCCAA
AGAATACATTGAGGAATTGGAAAAACAGCACAAACAACGAAAAGTACAACTAGCAAGCGCCCCAATTTTT
CACGAGAAGAAACAAGAAGATGATTTGAATAAAAAAGAAATAAATCTACCTGAACAACCGATCGAATCAG
AAGTAACAGAAGAAGAGGAAGAAAAAGAACTATTAATGAGTGATATTCTAAGTAGTTTTGATGAAGGTAT
AGAGGAAAACACAACCAACAATGACAACAGCGAATTACCATTTTAA
 Primer design