SecReT4
Protein ID: 269124263
T4SS name [ID]Tra_p [639]
Gene symbol-
Locus tagpAMbeta1_p28
StrainEnterococcus faecalis plasmid pAMbeta1 (NC_013514)
Repliconplasmid pAMbeta1 [GenBank: NC_013514] [Browse all T4SS(s) in this replicon]
Location [Strand]23564..24487 [+]
ProductAM29
Component typeOrf11_p
UniProt IDD1MAW5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 307 a.a.     [Download]
>gi|269124263|ref|YP_003305373.1| AM29 [Enterococcus faecalis]
MNGLKEFFGNIPMFQKQVEREIEEKGIEPSEGIKKMEFSRQVIRNLVIGVLVVGILAFVGISYFNNKNQP
PVTPTATTASKESNQSETSGEATENSSQAVQGSSDHLLKLSAKERADEATEAFESWYKSFSNGDVILEIN
KELLKEGSGGTSPIELQTKLIDNLKAKFGDKVADDFYTSLQTSFNFNPVIVDGSKGLTISKQNDDKSQWL
RTWFLDTQKTEKNTKIVLRNDFPYEWADWRNKGQHDEKVGSMFSQIDWDNDLRYEVIGLVTSKQEKNIEN
IGGVFVVMQYNEKIGKWQVSGTIGGVM
 
Nucleotide Sequence: 924 bp     [Download]
>gi|269124235|ref|NC_013514.1|:23564-24487 Enterococcus faecalis plasmid pAMbeta1, complete sequence
ATGAATGGATTGAAAGAATTTTTTGGGAATATCCCAATGTTTCAAAAGCAAGTAGAACGAGAAATCGAAG
AAAAAGGGATTGAACCTAGTGAGGGTATTAAAAAAATGGAATTTAGCCGTCAAGTGATCCGTAACTTAGT
GATTGGCGTTTTAGTTGTCGGTATTCTTGCTTTTGTGGGCATTTCTTATTTTAACAATAAGAATCAACCA
CCAGTGACACCAACAGCCACCACCGCAAGCAAAGAAAGTAACCAGTCAGAAACAAGCGGAGAAGCCACAG
AAAACAGCTCACAAGCCGTTCAAGGGTCAAGCGACCATTTACTCAAATTAAGTGCGAAAGAACGAGCAGA
CGAAGCGACAGAAGCGTTTGAGAGTTGGTACAAGTCTTTCTCTAATGGTGACGTGATTTTAGAAATCAAC
AAAGAATTATTGAAAGAAGGATCAGGCGGTACAAGCCCGATTGAATTACAAACAAAACTGATTGATAACT
TAAAAGCCAAATTTGGCGATAAGGTAGCAGATGATTTTTATACGAGTTTGCAAACAAGTTTCAATTTCAA
TCCAGTGATCGTTGACGGTAGCAAAGGGCTAACGATTTCTAAGCAAAATGACGATAAAAGCCAATGGTTG
CGTACCTGGTTCTTAGATACCCAAAAAACAGAAAAGAATACGAAAATTGTTTTGCGTAATGATTTTCCCT
ATGAGTGGGCAGATTGGCGTAACAAAGGACAACATGATGAAAAAGTAGGATCAATGTTTTCACAAATTGA
TTGGGATAATGATTTGAGATATGAGGTTATAGGGCTAGTAACTAGCAAACAAGAGAAGAATATTGAAAAC
ATTGGTGGAGTATTTGTAGTTATGCAATACAACGAAAAAATAGGAAAATGGCAAGTTAGTGGAACGATTG
GTGGTGTAATGTAA
 Primer design